PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678448348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 761aa    MW: 84400.6 Da    PI: 7.9163
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678448348genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.31.4e-35140216177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +Cqv gCead++e+k yh+rh+vC ++++a+ v ++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k 
  678448348 140 RCQVSGCEADITELKGYHKRHRVCLHCANASCVEIDGEQKRYCQQCGKFHPLPDFDEGKRSCRRKLERHNNRRRRKP 216
                6***********************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-27137202IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.103138215IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-32139218IPR004333Transcription factor, SBP-box
PfamPF031105.0E-27141215IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 761 aa     Download sequence    Send to blast
MQQNHPSPVS APQYLPAGTE MAAIGVPGLA NISPSDINSS FDWSELLDFN VNETFVIPFP  60
EAGTGADSGA EPGVIGSSSP ENVSRIRKRD PRLLCPNFLA GRVPCVCPDM DEKTAAEEEA  120
ALPGKKRTRT GRVVGGRPIR CQVSGCEADI TELKGYHKRH RVCLHCANAS CVEIDGEQKR  180
YCQQCGKFHP LPDFDEGKRS CRRKLERHNN RRRRKPDDSK QSRVKEAQQI NLEDDVSGDD  240
DSGKDGICVS SRVKEGRPSL ESEGQEPCPS LGSQKQQSDD INADTQKQNS IQRSSPSSGE  300
NKNTFSSACP TARISFKLYD WNPAEFPRRL RLQIFQWLAS MPVELEGYIR PGCTILTAFV  360
AMPRPMWRKL LDDPIMNIRD LISSPGNELS RGGSMLIYMN DMAFRVTKDR NSLVKIKVKD  420
CCPRLHYVHP TCFVAGRPIE FVACGSNLLQ SNLRFLISFS GRYLAYNISV PSRCRMEIFG  480
PSFDHQLVKI VAPLTDENLV GPAFIEVENQ SGLSNFVPIL VGDRETCDEM QHLIQDLDIS  540
PFSGVMKPCL SCKIMAARQA RLSEFLLDVA WLLKPEREKA LTASDVPRFN SLIKFLVEKE  600
SSAVLERVLR SLSSALSKYS GDGISLTDMS ALQKNISNAE CTLLLSRGKF CIPCSKMPDQ  660
LAAPATEIVK HASMARDTSE SQDSCSTVPL LAGDVEMNFD RSNANTRRNF RLPLRPSFLS  720
SRSLMAIAAI VFCIGACMLI FHPHSVSLIA VTIRRCMFDM S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A2e-39136219184squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201213RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678448348
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071504.10.0squamosa promoter-binding-like protein 7
TrEMBLA0A2G9GY100.0A0A2G9GY10_9LAMI; Uncharacterized protein
STRINGMigut.N00133.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA54072433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-166squamosa promoter binding protein-like 7