PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678448036
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 201aa    MW: 22809.8 Da    PI: 8.5686
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678448036genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.95.7e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               krie+ks rqvtfskRrng+lKKA ELS+LC+a+v vi++sstgkly yss
  678448036  9 KRIEEKSARQVTFSKRRNGLLKKARELSILCAADVGVIVYSSTGKLYQYSS 59
               79***********************************************96 PP

2K-box29.62.8e-11911681895
      K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                + +++      e Lqr  R+l   + ++ sl +L  Le+qLe +l +i++ K++ll++ ++ l++ ek+l+ee+  L+
  678448036  91 CSKYSEYITSEELLQRVERQLAEPCDDNDSLVDLVVLENQLEVALFQIKNAKTHLLIKTMSGLREEEKSLREEKSLLE 168
                5555555556677888888888888888899******************************************99886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.1E-35160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.478161IPR002100Transcription factor, MADS-box
CDDcd002655.53E-36279No hitNo description
SuperFamilySSF554551.83E-28277IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512977.84687178IPR002487Transcription factor, K-box
PfamPF014869.0E-9102169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGRRRLEIKR IEEKSARQVT FSKRRNGLLK KARELSILCA ADVGVIVYSS TGKLYQYSSG  60
NSLPRTVWRY YNYAESGKSP TDGDCKEQAD CSKYSEYITS EELLQRVERQ LAEPCDDNDS  120
LVDLVVLENQ LEVALFQIKN AKTHLLIKTM SGLREEEKSL REEKSLLESN KIGKKKVKPT  180
NGNLDLNAAP DDQPGDYNGN R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-20187186MEF2C
5f28_B2e-20187186MEF2C
5f28_C2e-20187186MEF2C
5f28_D2e-20187186MEF2C
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678448036
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071241.12e-58agamous-like MADS-box protein AGL27 isoform X4
TrEMBLB2DCP71e-62B2DCP7_9LAMI; RIN-like MADS-box protein
STRINGXP_009795052.12e-57(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65080.13e-25MIKC_MADS family protein