PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678447786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 361aa    MW: 39816.7 Da    PI: 6.0393
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678447786genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.58e-254396155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               k+r++Wt +LH+rFv+a  qL G+e A+Pk+ile+m+v++Lt+e+++SHLQkYR 
  678447786 43 KKRVEWTADLHSRFVKACIQL-GPEYAVPKRILEVMGVPDLTREQIASHLQKYRN 96
               68*******************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.0564099IPR017930Myb domain
SuperFamilySSF466898.96E-1741100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-244299IPR009057Homeodomain-like
TIGRFAMsTIGR015575.1E-234396IPR006447Myb domain, plants
PfamPF002491.1E-74595IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
LDFGVQRQEP ILRDSVAYES YMPAPTSTHR GNSIKLKKCH LRKKRVEWTA DLHSRFVKAC  60
IQLGPEYAVP KRILEVMGVP DLTREQIASH LQKYRNSMKS FGSDDPSVSS SNTKEDLEGQ  120
CASHTLKGIY RSLGTSFVPE MLITTSSLQS LYSDEAFSSG STSKLGFCGG PSASRIHGQS  180
GPEMPDILSC TDQMISLLPL PIEVVFPGDD CKHHIGHFTG YVMTNSQISV QRVKLEDSSS  240
SCASKEVEHS LGSFLLGEAV GGHGDGNQIM VPHWSPSQEH LAFPMSSSKN YSLQEKPGDD  300
ELQYYSPTPI FDHIAEHVYS PALLPPEDQY LDHLLGQQPN AGAANQIKWD FHIDDSFLLY  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-154299461ARR10-B
Cis-element ? help Back to Top
SourceLink
PlantRegMap678447786
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8132384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.22e-17response regulator 1