PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678447683
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family bZIP
Protein Properties Length: 369aa    MW: 41688.3 Da    PI: 8.5531
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678447683genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.71.6e-1096131338
                XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
     bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeL 38 
                e+k ++r+++NReAAr+sR RKka++++Le++  +L
  678447683  96 EDKIQKRLAQNREAARKSRMRKKAYVQQLETERLKL 131
                6899**************************865444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-894138No hitNo description
SMARTSM003382.5E-794164IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.24396140IPR004827Basic-leucine zipper domain
PfamPF001701.5E-796133IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.55E-798133No hitNo description
PROSITE patternPS000360101116IPR004827Basic-leucine zipper domain
PfamPF141443.9E-25184257IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MGMDLAEIRN RKPVFLLPNT NWDLYDWMLQ GSCFWREAFD RKHRKERTAT RNTAGDNLKK  60
GFHVLSSFTF SSAAFDSNTS PGSSVSIIAG TETKLEDKIQ KRLAQNREAA RKSRMRKKAY  120
VQQLETERLK LAQLEVELER ARHHGLFNAT AAAHIGAYGT VNSGVAAFDM EYAHWVDVQE  180
AKIYELKNGV QSGICEAELR IMVESILSHY CDLFRMKRDA ARFDAFYVVS GMWRTSVERF  240
FLWIGGFRPS ELITVVKPHL GPLREDQVNS VDSLRHSCAQ AEEALSQGMD KLQQTLAQSL  300
AFLASGAGSY CSQTAAALDK LESLEGFIHQ NGRAPVFSGG TYHRATYSDQ VYRSGLSVFC  360
KFEFYGWLL
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1 (By similarity). {ECO:0000250, ECO:0000269|PubMed:12953119}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678447683
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011097899.11e-128transcription factor TGA4 isoform X2
SwissprotQ93ZE27e-90TGA7_ARATH; Transcription factor TGA7
TrEMBLA0A4D8ZUK41e-118A0A4D8ZUK4_SALSN; Transcription factor TGA
STRINGMigut.C00214.1.p1e-118(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77920.17e-92bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]