PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678445865
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 691aa    MW: 75950.3 Da    PI: 6.0245
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678445865genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.9e-16423460340
        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                +++CnCkkskClk+YCeCfaag++C ++C C dC+Nk 
  678445865 423 CRRCNCKKSKCLKLYCECFAAGVYCVDQCACIDCFNKP 460
                789*********************************96 PP

2TCR44.92.3e-14507541135
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCed 35 
                ++k+gCnCk+s ClkkYCeC++ g+ Cs +C+Ce+
  678445865 507 RHKRGCNCKRSGCLKKYCECYQGGVGCSINCRCEG 541
                589******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.9E-17421462IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.87422547IPR005172CRC domain
PfamPF036383.7E-12424459IPR005172CRC domain
SMARTSM011145.2E-13507544IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.7E-10509541IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MASFHLDFGC PSLHSCSWLC SDMTDVESVD DSPVFSFIND LSPIKPLKCN HLSHMMIPLS  60
FSSLPSVFTS PHVSSFRALQ RHQLQDPSTP EFASDSGITV EGSQVNTAKE LDEQEGTIKS  120
SESDGELAVE TSLHCLRFSG GEFPNSSPIH HEVVCESEVD KKGKSLADQN THVMSYEWED  180
FNEALIFESP NDKASCNEKI CPSNQNGVHG IQSFCEDVPN EQQHLSSQPG PGEGMQTAEV  240
PEMEVDTSLN RFGEENPSGI YRGTRRRCLV FEVGCTLRKH MQQPSGSDSS LMLQSETSAF  300
SNDQNLLHMK PGNSPSSHVL PAIGLHLNAL ATTPGVSLSH DLSTPGRLLI GPNSSVNFHF  360
SPSSEVLLNN MLSASLDEEG ENIIVPLEDP YQTSAHMEIE GMNHSSPKKK RRRAEASGNA  420
EGCRRCNCKK SKCLKLYCEC FAAGVYCVDQ CACIDCFNKP VNEHKVLETR KQIESRNPLA  480
FAPKVIRGTN PLAETGDDST ETPASARHKR GCNCKRSGCL KKYCECYQGG VGCSINCRCE  540
GIEPEEIDEA DRVNMTSMLD KNSHKILLEN DSCIPATLLP VGRQLLQQQY SSKPKSARVA  600
SSFPRVGMMF DKQSFHPQPP AKFRHHLETV MEDHETPGFL QGILSSTNCV VKSSSPNGKR  660
VSSPNIITGL RSSRKLILQS IPSFPSLTYD E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-1742654314119Protein lin-54 homolog
5fd3_B6e-1742654314119Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1407412KKKRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMap678445865
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2G9GVD90.0A0A2G9GVD9_9LAMI; Metallothionein-like protein
STRINGMigut.G00370.1.p1e-175(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-104Tesmin/TSO1-like CXC domain-containing protein