PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678445349
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 227aa    MW: 24416.2 Da    PI: 6.7218
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678445349genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.5e-3149102154
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                k+rlrWt++LHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQ  R
  678445349  49 KQRLRWTHDLHERFVDAVSQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQVQR 102
                79*************************************************877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.27246106IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.3E-2947102IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1548103IPR009057Homeodomain-like
TIGRFAMsTIGR015578.8E-2449103IPR006447Myb domain, plants
PfamPF002491.8E-751100IPR001005SANT/Myb domain
PfamPF143797.4E-1097124IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MHQPNAVPNP SLVNTSPGLL HPTVDCGTNA MDPAAGSNGA NSNRNSASKQ RLRWTHDLHE  60
RFVDAVSQLG GPDRATPKGV LRIMGVQGLT IYHVKSHLQV QRQLQLRIEA QGKYLKKIIE  120
EQQRLSGVLS EAPGLGADTG PLDPENMDPP TPVPTSESPP MDNPPKELAP GQSSHSVEES  180
FLQHEPLTSD SDTPTARPAK KQRSSNDSSF SKPCMAPTNS ILESSLS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095856.12e-83PREDICTED: myb family transcription factor APL-like
RefseqXP_011095855.12e-83PREDICTED: myb family transcription factor APL-like
TrEMBLF6HD662e-76F6HD66_VITVI; Putative uncharacterized protein
STRINGVIT_00s0475g00040.t016e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27962451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-43G2-like family protein