PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678444473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WRKY
Protein Properties Length: 465aa    MW: 51049.5 Da    PI: 8.4593
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678444473genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.17.6e-33186243260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d+ ++ei+Y+g+Hnh+k
  678444473 186 DDGYNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSI-DGPITEIVYKGTHNHPK 243
                8****************************************.***************85 PP

2WRKY106.81.1e-33335393159
                ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                ldDgy+WrKYGqK+vkg+++prsYY+Ct+ gCpv+k+vers++dp++v++tYeg+H+h+
  678444473 335 LDDGYKWRKYGQKVVKGNPNPRSYYKCTTLGCPVRKHVERSSSDPRAVITTYEGKHDHD 393
                59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-28180244IPR003657WRKY domain
PROSITE profilePS5081124.593180244IPR003657WRKY domain
SuperFamilySSF1182906.93E-26182244IPR003657WRKY domain
SMARTSM007741.0E-35185243IPR003657WRKY domain
PfamPF031067.5E-26186242IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.5E-37320395IPR003657WRKY domain
SuperFamilySSF1182901.7E-29327395IPR003657WRKY domain
PROSITE profilePS5081138.182330395IPR003657WRKY domain
SMARTSM007742.9E-39335394IPR003657WRKY domain
PfamPF031069.3E-26336392IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MSPCPHRTCF DACEVSISLR RRTRFRFSTQ RAVSMADSSS FGNFDFCVDS SSWQGKAMAS  60
GGFRDGGVSG NEFPKFRSLP PPSLPIPPPS LVSPSSWFSI PPGLSPGELL DSPVLLAASN  120
ASTSPATGEF PVPMSLVWNN ASELVKQQND TQNENFSFSF PTEAKFRTPC GQEQRNFNPS  180
SKKMEDDGYN WRKYGQKQVK GSENPRSYYK CTYPNCPTKK KVERSIDGPI TEIVYKGTHN  240
HPKPQSTRRS SVSSSSNHLY AAKMDSSSSV VTTETASSPG DDDFEDSRDD FDGNQEPGAK  300
RWKSEHESGG GSSTGSNAVR EPRVVVQTTS DIDILDDGYK WRKYGQKVVK GNPNPRSYYK  360
CTTLGCPVRK HVERSSSDPR AVITTYEGKH DHDVPVGRGE AGRLLGGQPP HYPQVPSFGS  420
LAPGGGATAQ APHTLQMVHR LGYHHQGVPK AEPREEDDFV NSLLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-36184395877Probable WRKY transcription factor 4
2lex_A4e-36184395877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014489595.11e-117PREDICTED: probable WRKY transcription factor 26
SwissprotQ8S8P51e-105WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLA0A0S3S6141e-118A0A0S3S614_PHAAN; Uncharacterized protein
STRINGGLYMA11G29720.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22862460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.13e-94WRKY DNA-binding protein 33