PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678443816
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family WOX
Protein Properties Length: 206aa    MW: 23595.1 Da    PI: 6.9324
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678443816genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.22.1e-211574357
               --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               +R+++tkeq+  Le l+++  r+psae++++++++l    +++ ++V++WFqN++a++++
  678443816 15 SRWNPTKEQIAMLEGLYKQgLRTPSAEQIQQISNRLkdfgHIEGKNVFYWFQNHKARQRQ 74
               6*****************99**************************************97 PP

2Wus_type_Homeobox113.31.3e-361576465
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +RW+Pt+eQi +Le lyk+GlrtP++e+iq+i+++L+ +G+ie+kNVfyWFQN+kaR+rqkq
          678443816 15 SRWNPTKEQIAMLEGLYKQGLRTPSAEQIQQISNRLKDFGHIEGKNVFYWFQNHKARQRQKQ 76
                       8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.42E-14980IPR009057Homeodomain-like
PROSITE profilePS5007110.91075IPR001356Homeobox domain
SMARTSM003892.0E-51279IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.6E-91574IPR009057Homeodomain-like
PfamPF000464.7E-191574IPR001356Homeobox domain
CDDcd000862.84E-61676No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MEGGDGSHGN GSGGSRWNPT KEQIAMLEGL YKQGLRTPSA EQIQQISNRL KDFGHIEGKN  60
VFYWFQNHKA RQRQKQKQED LAYFNTFLHQ AHPILPPPYH HHPQVICSSP CYSVAPNPTR  120
SHHQFMYHQQ QHYEKQLQIA GARGMKRSRG SVEEQNGNIS TNHITETLDL FPVHPTGLLE  180
ESTAEKEQNE EGEEEGWFSM GVEKNH
Cis-element ? help Back to Top
SourceLink
PlantRegMap678443816
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012834494.17e-54PREDICTED: WUSCHEL-related homeobox 2-like
TrEMBLA0A4D9BTG51e-66A0A4D9BTG5_SALSN; Uncharacterized protein
STRINGMigut.F01969.1.p3e-53(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-40WUSCHEL related homeobox 2