PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678442830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family HD-ZIP
Protein Properties Length: 265aa    MW: 30557.1 Da    PI: 4.7408
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678442830genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.4e-1963116356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ +q++ Le++F  ++++  +++ ++A++lgL+ rq+++WFqNrRa++k
  678442830  63 KKRRLSMDQVQFLEKCFIADNKLEPDRKLQIARELGLQPRQITIWFQNRRARWK 116
                56689************************************************9 PP

2HD-ZIP_I/II124.74.1e-4062152191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  ekkrrls +qv++LE++F +++kLep+rK ++areLglqprq+ +WFqnrRAR+kt+qlE+dyeaL+r+y++lk+e ++L +++e+L++e+
    678442830  62 EKKRRLSMDQVQFLEKCFIADNKLEPDRKLQIARELGLQPRQITIWFQNRRARWKTRQLETDYEALHRSYETLKAEYDNLFSDHEKLKAEI 152
                  69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.71E-1942120IPR009057Homeodomain-like
PROSITE profilePS5007116.66558118IPR001356Homeobox domain
SMARTSM003891.9E-1861122IPR001356Homeobox domain
CDDcd000861.00E-1663119No hitNo description
PfamPF000462.0E-1663116IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.5E-1868116IPR009057Homeodomain-like
PRINTSPR000311.9E-58998IPR000047Helix-turn-helix motif
PROSITE patternPS00027093116IPR017970Homeobox, conserved site
PRINTSPR000311.9E-598114IPR000047Helix-turn-helix motif
PfamPF021831.7E-12119156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MASQIGMVNR SKNARVTSPN HHRGSGAILN FGASTVGNSF IYPFDPEENG DEFLDEFLSQ  60
PEKKRRLSMD QVQFLEKCFI ADNKLEPDRK LQIARELGLQ PRQITIWFQN RRARWKTRQL  120
ETDYEALHRS YETLKAEYDN LFSDHEKLKA EILYLKTTSE PELQPQGYEQ SSRSATAEDQ  180
VSAMISRNEP RGSVISDVVY EESLLFAGGM SYTLEPGHPN QIPNLEDEFQ RPEYILSRVE  240
VSHYLPNGFF LEFPVEDPLP GCWSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087214.11e-65PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ8LC033e-38ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLA0A022Q9Z14e-62A0A022Q9Z1_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-39HD-ZIP family protein