PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678442371
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 336aa    MW: 36711.7 Da    PI: 5.9288
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678442371genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.62.4e-32188243156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k r++W+peLH+rFv a+eqLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  678442371 188 KSRRCWSPELHRRFVAALEQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 243
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.589185245IPR017930Myb domain
SuperFamilySSF466894.78E-18186246IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-29186246IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26188243IPR006447Myb domain, plants
PfamPF002492.7E-7190241IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVLNGHNHCG FSGKNRRCEE YMQALEEERR KIEVFQRELP LCLELVTQAI DSCKQQLSGT  60
TSECDFNGQS ECNSDHTSGE IPVFQELIPI KTSSLCEEHE LGDGDELEKS DWLRSVQLWH  120
NQTPDPVTKE TSPRKVAVVE VKGTGAFHPF KKDQTNKGGG TTSPNDIPAN PPPATGNKED  180
RDGQSHRKSR RCWSPELHRR FVAALEQLGG SHVATPKQIR ELMKVDGLTN DEVKSHLQKY  240
RLHTRRPSPT IQLSTANPPP QLAVVVSGIW ALPQEYATMA TSGEVGSGAA AAADNDICAP  300
IALKSSNSDN SGWPEDGDSP STSSSTQTTT GSPPLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14188241154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14188241154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14188241154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14188241154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14188241255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678442371
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070832.11e-121myb family transcription factor EFM
SwissprotQ9FPE81e-82HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A2G9GW561e-118A0A2G9GW56_9LAMI; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.12e-81G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]