PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678442138
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 318aa    MW: 35499.2 Da    PI: 7.5316
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678442138genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.5e-4125101278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC adls +++yhrrhkvCevhsk+p v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  678442138  25 CLVDGCVADLSLCRDYHRRHKVCEVHSKSPRVTIEGREQRFCQQCSRFHSLAEFDEGKRSCRKRLEGHNRRRRKPQP 101
                **************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.5E-331886IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.2482299IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.92E-3823104IPR004333Transcription factor, SBP-box
PfamPF031102.1E-302598IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MDSSSFLGSS KRAKAPSSSN QIPHCLVDGC VADLSLCRDY HRRHKVCEVH SKSPRVTIEG  60
REQRFCQQCS RFHSLAEFDE GKRSCRKRLE GHNRRRRKPQ PESLAQNPAF LFTNQASFSG  120
SRILSFGDQQ VLPSSVLAPK TWPGLVKVEN DMTPYGGNQH QPMEYNQTPD AFLKYPAFSF  180
KGLQDDHHHL QFHESSSSST ARNPNFFSDG LNHHPFADCD RALSLLSPAP EATAHDFSLT  240
HTGTEPIRGT QPSVGRDYSY HNLSLLHHQL PEENKAGVAA SSQYQDSNAS TAHVPEMFHH  300
GEGSSGSGSH QTLSFMWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-281598184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18198KRSCRKRLEGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678442138
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022881716.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881717.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881718.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881719.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881720.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881721.16e-86squamosa promoter-binding-like protein 16
RefseqXP_022881722.16e-86squamosa promoter-binding-like protein 16
TrEMBLA0A2G9FXF54e-94A0A2G9FXF5_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-51SBP family protein