PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678442123
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 340aa    MW: 37881.8 Da    PI: 9.4593
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678442123genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP123.31.1e-38112189178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +C vegC++dls+ak yhr+h+vCe hsk+ +v++sg+e+rfCqqCsrfh lsefD++krsCrrrL +hn+rrrk+q 
  678442123 112 RCIVEGCSVDLSSAKGYHRKHRVCEYHSKCFKVVISGVERRFCQQCSRFHILSEFDDKKRSCRRRLYDHNARRRKPQL 189
                6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-30107174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.522110187IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-37111192IPR004333Transcription factor, SBP-box
PfamPF031106.4E-29113186IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010358Biological Processleaf shaping
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGSIRDHAYA TKYSRTASVE SSIVDGGIQN PISRLMTSED FPKCSYMGTL IKDAEFFGTS  60
SLLAQASVGA LEPLIGLKLG KRTYFENTGT PSSLNLSTSS RHKSSFQNRI PRCIVEGCSV  120
DLSSAKGYHR KHRVCEYHSK CFKVVISGVE RRFCQQCSRF HILSEFDDKK RSCRRRLYDH  180
NARRRKPQLE TFHINAAALS SSFYGGKQMS FRLINGSACH SGELGSSVWD HTSSSPKFTI  240
TGGYPTKLGR GTRNSSHPEV APEHFGAYSL LSASHRDSRG VESVPFHCQG MPCAAEPVLH  300
GMHEHLLPFS YGEIPSSWSL PKIQTFRTPY ESDFYANTLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-251131861184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168185KKRSCRRRLYDHNARRRK
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678442123
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086806.11e-78squamosa promoter-binding-like protein 12
RefseqXP_011086808.11e-78squamosa promoter-binding-like protein 12
RefseqXP_020551644.11e-78squamosa promoter-binding-like protein 12
SwissprotA2X0Q62e-52SPL3_ORYSI; Squamosa promoter-binding-like protein 3
SwissprotA3A2Z82e-52SPL3_ORYSJ; Squamosa promoter-binding-like protein 3
TrEMBLA0A075FJ542e-76A0A075FJ54_SALMI; SQUAMOSA promoter binding protein-like 5 (Fragment)
STRINGMigut.K00951.1.p1e-76(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41292444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.31e-46squamosa promoter binding protein-like 2