PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678441767
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 354aa    MW: 39675.7 Da    PI: 6.8039
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678441767genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.33.1e-2789138251
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                prlrWtpeLH +Fv a+e+LGG+e+AtPk++l+lm+v gL+++hvkSHLQ
  678441767  89 PRLRWTPELHLSFVGAIERLGGQERATPKAVLQLMNVRGLSISHVKSHLQ 138
                8************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.35385145IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.8E-2485138IPR009057Homeodomain-like
SuperFamilySSF466896.81E-1288138IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-2089139IPR006447Myb domain, plants
PfamPF002491.8E-690138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MAEESKTRGT DEEEAENLRS NSREVEEEVN QDDDAASSIN LNEKAGSNVI GGQQAAAGDD  60
RSVDVSSKSG GEGSERKSTV RQYIRSKLPR LRWTPELHLS FVGAIERLGG QERATPKAVL  120
QLMNVRGLSI SHVKSHLQGL VDNGDFHLFL HPSYYWEGVT TRDDDDDDAV LGQAGRLYGI  180
HGRNQFLGSP YMRCSSSSPL HQLKFENGGI VLVRNPDPNR YVERLRSFSQ NPDIRYPYDF  240
KSLSSRYQQW HSSQHELRNR LNSRVGSDIG MIDNKSTAPL RPNQFHQGRV WPPRELISSH  300
SIDKDPSNSL KANQGKEEGD LQLTLSLGPC NNNETKDLSK RNNHSEINTK LSLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A7e-1790138351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-1790138351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-1790138351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-1790138351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678441767
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G9HMS95e-70A0A2G9HMS9_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-27G2-like family protein