PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678436259
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 265aa    MW: 30068.4 Da    PI: 6.5018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678436259genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.94.1e-53281561128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                +ppGfrFhPtdeelv++yL+ kv +       v i+evd++++ePwdLp+ +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd+ev+   +++
  678436259  28 MPPGFRFHPTDEELVTFYLASKVFNGVGFY-GVqIAEVDLNRCEPWDLPEGAKMGEREWYFFSMRDRKYPTGVRTNRATGAGYWKATGKDREVYGDcGRS 126
                79********************99988444.444***************9889999**************************************997788 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                l+g+kktLvfy+grap+gekt+Wvmheyrl
  678436259 127 LIGMKKTLVFYTGRAPRGEKTKWVMHEYRL 156
                8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-6123178IPR003441NAC domain
PROSITE profilePS5100558.928178IPR003441NAC domain
PfamPF023651.2E-2829156IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010014Biological Processmeristem initiation
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MMMMMLGIEE ILCELQGGEE KATAGMGMPP GFRFHPTDEE LVTFYLASKV FNGVGFYGVQ  60
IAEVDLNRCE PWDLPEGAKM GEREWYFFSM RDRKYPTGVR TNRATGAGYW KATGKDREVY  120
GDCGRSLIGM KKTLVFYTGR APRGEKTKWV MHEYRLDGHF SCRHLVKEEW VMCRIFHKIC  180
SSSDKKNPGD LTPALQNHLI SDFYLPPARD KGCCGGRGDA TLPSLQHLPG CWGVGDEEED  240
EKRKACGFGE IQMGMNHYID CGNWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-52191786168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00241DAPTransfer from AT1G76420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016571397.11e-100PREDICTED: protein CUP-SHAPED COTYLEDON 3
SwissprotQ9S8515e-90NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A059BWH46e-98A0A059BWH4_EUCGR; Uncharacterized protein
TrEMBLS8CHB63e-99S8CHB6_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000256906e-95(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76420.12e-89NAC family protein