PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678435814
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 299aa    MW: 33993.4 Da    PI: 5.7114
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678435814genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.47.3e-50481721128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelv 100
                lp GfrFhPtdeelv +yL++k++g+++++ +v++evdiykv+Pw+Lp     +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg dk+v +   ++ 
  678435814  48 LPSGFRFHPTDEELVLDYLCRKCSGDRIPA-SVVAEVDIYKVDPWELPGLSLYGEKEWYFFSPRDRKYPNGSRPNRVAGSGYWKATGADKPVGK--PRTL 144
                699***************************.99***************64455799************************************98..6789 PP

        NAM 101 glkktLvfykgrapkgektdWvmheyrl 128
                 +kk Lvfy g+ p+g+kt+W+mheyrl
  678435814 145 AIKKALVFYAGKPPRGVKTNWIMHEYRL 172
                **************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-5942198IPR003441NAC domain
PROSITE profilePS5100557.96448198IPR003441NAC domain
PfamPF023655.3E-2549172IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MDLLHDGLRA RKISTPEKFK IEAAQHCQTP SWLSWMSKVQ GQLQGLNLPS GFRFHPTDEE  60
LVLDYLCRKC SGDRIPASVV AEVDIYKVDP WELPGLSLYG EKEWYFFSPR DRKYPNGSRP  120
NRVAGSGYWK ATGADKPVGK PRTLAIKKAL VFYAGKPPRG VKTNWIMHEY RLANVDRSAG  180
KRINSKLDDW VLCRIYNKKG TMEKHYLTDQ KGAHFSDSEE DERSSAATFL GDALPDMTSG  240
SNEYASPESN PGESIRSSPD IQDLDFLMDY GQSLEDDVMP EMLYNDQLAL FQEMLECFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-774620413174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099683.11e-114PREDICTED: NAC domain-containing protein 2-like
SwissprotQ9C5981e-100NAC81_ARATH; Protein ATAF2
TrEMBLA7LKM81e-111A7LKM8_AVIMR; NAC transcription factor
STRINGSolyc04g009440.2.11e-100(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12392481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08790.11e-100NAC family protein