PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678434817
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 86aa    MW: 9974.97 Da    PI: 5.0613
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678434817genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM583.2e-181561249
        NAM  2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk 49
               ppGfrFhPtdeelv +yLk+kv +k+++  ++i e+d+yk++P++Lp 
  678434817 15 PPGFRFHPTDEELVGYYLKRKVCRKRHHR-DMIGETDVYKCDPEELPG 61
               9*************************998.99**************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-181263IPR003441NAC domain
PROSITE profilePS5100518.9661486IPR003441NAC domain
PfamPF023654.7E-101583IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
MGLDSDCTDY GSDFPPGFRF HPTDEELVGY YLKRKVCRKR HHRDMIGETD VYKCDPEELP  60
GGFSYSSVNV DLSPRSLFPW FAFLLX
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074130.17e-25PREDICTED: NAC domain-containing protein 86-like
SwissprotQ9XIC56e-20NAC17_ARATH; NAC domain-containing protein 17
TrEMBLA0A022R8F52e-23A0A022R8F5_ERYGU; Uncharacterized protein
STRINGSolyc04g072220.2.11e-19(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34190.13e-21NAC domain containing protein 17