PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678434756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Nin-like
Protein Properties Length: 926aa    MW: 101435 Da    PI: 6.3886
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678434756genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.31.5e-28566616252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 k++sl++l++yFs+++kdAAk++gvc+T+LKriCR+yGI+RWP+Rki+++
  678434756 566 DKHVSLSVLQQYFSGSLKDAAKSIGVCPTTLKRICREYGIARWPSRKINKV 616
                6899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.62551636IPR003035RWP-RK domain
PfamPF020424.7E-25569616IPR003035RWP-RK domain
Gene3DG3DSA:3.10.20.2408.0E-21826909No hitNo description
SuperFamilySSF542771.86E-18826911No hitNo description
PROSITE profilePS5174520.872830912IPR000270PB1 domain
SMARTSM006661.8E-17830912IPR000270PB1 domain
PfamPF005641.5E-15831909IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MEYPGKERMN DQLTEIDGGS KHAVVMGSSY LHDTFSSTAE LMNLDTNAGF CSGSVDMSDF  60
SSPFFMMSPL DAVSMSFSPS FGASGITTDN GDVLGATLHC GEKLVLHDTD SHLPLATESA  120
NNEFEFVENF RSSHCNVPDY MGKTFISRPL KRSLAEKLLA ALHLFNEESG GGVLAQVWLP  180
LKKGDQYILS TCEQPYLLDQ TFFEYREISR SFTFSAESKP GSFPGLPGRV FLSKIPEWTS  240
NVLYYNKAEY LRVQYAAAYE VRGSIALPIL EVDSADTSCC AVLELVTRKE KSNFDPEIET  300
LCHALQNLSK GQRAALSDIA DVLRTVCHVH RLPLALTWMP CICTEEPGNE IIKIQPRGSH  360
NGSSGKHVLC VEDTASYVND KNMKGFLQTC LGHYLEEGKG VVGKALKSAH PFFYPDVKEY  420
HISEYPLVHH ARKFGLNAAV AIRLRSTHTE DDDYILEFFL PVTVTDGAEQ QLLLNNLSTT  480
MQRICTTLRT VSDTELLQSS ISMVQSPVDH EGITLGGNSS HMVVSGKMNH RHCSSGLPTL  540
GVQEARPSRQ GTGPVKQMGK KRSTADKHVS LSVLQQYFSG SLKDAAKSIG VCPTTLKRIC  600
REYGIARWPS RKINKVNRSL RKLQGVLDSV HVQGGLKLNS SMGILSTASL VQGSNSGMSA  660
MLSNGASLMG ESDSMFEDGK SASIPANLDV ENTVVREGET CLQSTGECVG AHVMGANHSW  720
IPKPSPVQWM PSAVPHVSTS VEASNGWAQN NSSSNPNPPA LPPLISQNLN SVLVDEHLHA  780
KSEDEGEGDQ QQVSSGSWNG SATILDGSSS SSRNFQRGHQ RTGAGDHGSR ITIKSSYKED  840
TVRFKFDPDL GCDHLYGMIA KRFQLQMGQF QLKYLDEEHE WILLVNHSDM RECLEVLNFQ  900
GARHLKIIVC DLGTSGASNW TPGNER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073897.10.0PREDICTED: protein NLP9
RefseqXP_011073898.10.0PREDICTED: protein NLP9
TrEMBLA0A022R8P40.0A0A022R8P4_ERYGU; Uncharacterized protein
STRINGSolyc11g045350.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA39812445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein