PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678433187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CO-like
Protein Properties Length: 387aa    MW: 42909.2 Da    PI: 6.5
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678433187genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.83.8e-0796134540
   zf-B_box   5 kCpeHeekelqlfCedCqqllCedClleeHkg....Htvv 40 
                 C+ + + e +l+C++++++lC +C + +H +    H++v
  678433187  96 LCEGCRSAESSLYCRQDSVFLCLSCDSRIH-SvarhHERV 134
                7******99*********************.447778776 PP

2zf-B_box27.28e-09134179342
   zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                 r C+ + + ++ + C+ ++  lC+ C ++ H+       H +vp+
  678433187 134 VRLCASCAHAPAVFLCKADSASLCAACDSKVHSAnplagrHHRVPI 179
                689*****************************66899999877775 PP

3CCT69.77.7e-24335379145
        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                Rea++lRY+eK+k+R+FeK+irY+sRKa+Ae RpR+KGrF+kq+e
  678433187 335 REARVLRYREKKKNRRFEKTIRYASRKAYAEVRPRIKGRFAKQPE 379
                9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011911.50592136IPR000315B-box-type zinc finger
SMARTSM003366.1E-892136IPR000315B-box-type zinc finger
CDDcd000213.47E-795136No hitNo description
PROSITE profilePS5011910.637132179IPR000315B-box-type zinc finger
PfamPF006432.8E-7134179IPR000315B-box-type zinc finger
CDDcd000214.64E-7135179No hitNo description
SMARTSM003361.0E-7137179IPR000315B-box-type zinc finger
PROSITE profilePS5101716.489335377IPR010402CCT domain
PfamPF062031.4E-17335377IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGFNLQAPAK TNPVRPLFSD HKSFGQLLAT GFAPRGVERI EHDARGPEAL NFCPLIAALF  60
IFSTALLLVC ADTAPSLENR VTKLTEMLDV KAAGVLCEGC RSAESSLYCR QDSVFLCLSC  120
DSRIHSVARH HERVRLCASC AHAPAVFLCK ADSASLCAAC DSKVHSANPL AGRHHRVPIR  180
AMTDGISSPV AHTFTGSSIP ESSDGGVMEN DADEDDEEAV SWLLHNPLIT KASDSNGLRY  240
GEFQELTDFG SAPNLDQCNE EQSNQQQDYD VPQRHFFQLG LEYDDPKAVD FFSASSFYNT  300
QQGMVPDTAN TQVSFTQIKQ LTDASDAFPS CDMDREARVL RYREKKKNRR FEKTIRYASR  360
KAYAEVRPRI KGRFAKQPER CVQVTQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029446.13e-71PREDICTED: zinc finger protein CONSTANS-LIKE 2
STRINGPOPTR_0017s14410.16e-69(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52482337
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.11e-53CONSTANS-like 2