PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678431917
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family CPP
Protein Properties Length: 692aa    MW: 75930 Da    PI: 5.3815
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678431917genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.2e-16528565340
        TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                +++CnCkkskClk+YCeCfaag++C + C C dC+Nk 
  678431917 528 CRRCNCKKSKCLKLYCECFAAGVYCVDLCACIDCFNKP 565
                789*********************************96 PP

2TCR47.82.8e-15612650139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+C   
  678431917 612 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCIEA 650
                589*********************************765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.2E-17526567IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.729527652IPR005172CRC domain
PfamPF036383.7E-12529564IPR005172CRC domain
SMARTSM011145.1E-15612650IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.9E-11614648IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MQNVSVVFWL WVYVVLLLVG SPFVWSRERG GKDENVDSLT YVHSSSLLCF PLLLEPSVWA  60
WGGGGNCSET MCGEEEVMDT LDRSNNDQIA ASIARYEDSA VFNFIYDLSP IKPVKCSHLS  120
HTMIPLNFSS IPSVFTSPHV TSERDFKILH RHQFHDPSKP EFASENGVTI QGSQINTESS  180
KQLDAKEDSI MSIVSDLELP GETSVGCSHF AVDVSEGLVY SGGSPNSSSI HEAKNMVNYG  240
CDSLVLPSSS LEVPYGNEAD TRRKNHGYQN THIMSYEWQR LTDASFFGST NDRKSNIEQI  300
YPGLSELPGE ANEQHHLSSQ SGPVEGTHTA EAHETETDTS GNHICEQMDF DNLSGLYRGM  360
RRRCLVFEKG GTLRNHMQPT FGSDSSIMLQ SETAAFSSDQ NQVQMNPGNN PSCSAVPGIG  420
LHLNALATTP GVTHDLPTPG RLLMGANTRV DFHLSPSTEV LLSNILSVSL QEGKENTVVR  480
AEDTCQPSGH TEIEDMNQSS PKKKSVDFSN AFLGLRRRAE ASGNVEGCRR CNCKKSKCLK  540
LYCECFAAGV YCVDLCACID CFNKPVHEDT VLATRKQIES RNPLAFAPKV IRGSNPPSET  600
GDDTCKTPAS ARHKRGCNCK KSGCLKKYCE CYQGGVGCSI NCRCEGCIEA DEEDEMDRVD  660
IPSMPIPATP LLAGRQAYRK SYEAPLPLFI SN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1853165514126Protein lin-54 homolog
5fd3_B5e-1853165514126Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678431917
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A4D8ZDA41e-175A0A4D8ZDA4_SALSN; Uncharacterized protein
STRINGMigut.G00370.1.p1e-157(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.18e-84TESMIN/TSO1-like CXC 2