PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678431182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Dof
Protein Properties Length: 265aa    MW: 29327.9 Da    PI: 9.3152
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678431182genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.92e-372481461
     zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +l+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalr vP+Ggg+rk+kk+
  678431182 24 PSLRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRSVPIGGGCRKSKKM 81
               6789***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-252376IPR003851Zinc finger, Dof-type
PfamPF027011.0E-322580IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.0312680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MSTDKGKPEQ QQKKKSAAAR GQEPSLRCPR CDSPNTKFCY YNNYSLSQPR HFCKTCRRYW  60
TKGGALRSVP IGGGCRKSKK MKCSSKEMTG DAGGLRFFQG ISPAMDFQSA SQFGDILNNH  120
LPISATPPPP PPSFSLDPNC AGTSVAFPFK APNLTSFFQE TGGSYRSLAS SIESLSCINQ  180
DLHWRLQQQR LAAPNFIIPS IETTAAGTTA SLQKSQPVLF HGLEISNTKQ QQSDEARNPT  240
EWFFDNSYAT TPTNWSNIQS WNDFS
Cis-element ? help Back to Top
SourceLink
PlantRegMap678431182
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016734926.11e-78PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLA0A1U8N7462e-77A0A1U8N746_GOSHI; dof zinc finger protein DOF5.7-like
STRINGGorai.008G094000.11e-77(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-53Dof family protein