PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678430839
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 469aa    MW: 52871.8 Da    PI: 6.7079
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678430839genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.91.4e-51111401129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+++yL+kkv+g+k++l +vi++vd++k+ePwd++   k+ +  +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s   
  678430839  11 VPPGFRFHPTEEELLQYYLRKKVAGDKIDL-NVIHDVDLNKLEPWDIQDkcKIGSaPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS-CF 108
                69****************************.99**************952333333556**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                + +g++ktLvfy grap+g+ktdW+mheyrle
  678430839 109 TRIGMRKTLVFYGGRAPHGQKTDWIMHEYRLE 140
                99****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-578171IPR003441NAC domain
PROSITE profilePS5100556.07411171IPR003441NAC domain
PfamPF023656.8E-2812139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MDLSLNGHSN VPPGFRFHPT EEELLQYYLR KKVAGDKIDL NVIHDVDLNK LEPWDIQDKC  60
KIGSAPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKVIYSCFTR IGMRKTLVFY  120
GGRAPHGQKT DWIMHEYRLE DNKAHESSNA SNAMGDFGSE EGWVVCRVFK KKNHHKGAES  180
TSSSPSTLPR NDSVIDQLLM YMERSSYCSP EKDVKMHFST NQPMQLPGLE AQPLTNPSYA  240
QPEIKPSADW AALDRLVAFQ LNGQPCRHQN LIFSCGEQED DAQLITIQQC GEDEDDRGES  300
DLWNFARSSG SASDPLCHLS VYFAEAPLAC KEKVEEILGY MLTLQGQDEL KLDLQLSSSF  360
FLDSLSFYML TLLVFNRSLI AVAPHVVTSG AITGFETLCL DVVLRNIQHQ HGTSPSLLNS  420
TALNVVVVAV RCLRKSAQQR STAIVYTRCF HIQSQNTVYP LQCSYQFKG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-491017414171Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00016PBMTransfer from AT1G32770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070696.11e-136PREDICTED: NAC domain-containing protein 43-like
SwissprotQ9LPI71e-109NAC12_ARATH; NAC domain-containing protein 12
TrEMBLR4N7K11e-120R4N7K1_JATCU; NAC transcription factor 012
STRINGPGSC0003DMT4000293211e-117(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32770.12e-99NAC domain containing protein 12