PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678427101
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family ZF-HD
Protein Properties Length: 244aa    MW: 26827.2 Da    PI: 7.831
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678427101genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer97.31.2e-304398359
  ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
                  v+YkeC+kNhAa++GghavDGCgEfmp  g++ + + l CaACgCHRnFHR+e+++
    678427101 43 VVEYKECMKNHAANMGGHAVDGCGEFMPPIGAH-EEKLLICAACGCHRNFHRQEPDT 98
                 589*************************96665.8999***************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.1E-264496IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-1544104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-264595IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.4334695IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.3E-29132204IPR009057Homeodomain-like
SuperFamilySSF466892.24E-18133200IPR009057Homeodomain-like
TIGRFAMsTIGR015658.5E-26142199IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDLDMEPPVS PEENEVETPP HAALPARPPP PHFAKNRLQG PVVVEYKECM KNHAANMGGH  60
AVDGCGEFMP PIGAHEEKLL ICAACGCHRN FHRQEPDTSA ISPPFLDFRR HSSPNPRSPR  120
VLFGFADNQA PVTPTAENLA GRKRFRTKFS QEQKDKMYSF SEKIGWKMHR CDESAVESFC  180
REIGVTRGVL KVWMHNNKNM AAKKDPRGGG SGGACMNTQE GKPSDIGGHF HFHGANDGSS  240
SSPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-211431991874ZF-HD homeobox family protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678427101
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070997.12e-75zinc-finger homeodomain protein 10
SwissprotO647224e-48ZHD3_ARATH; Zinc-finger homeodomain protein 3
TrEMBLA0A4D8YIB33e-73A0A4D8YIB3_SALSN; Uncharacterized protein
STRINGSolyc05g007580.1.13e-57(Solanum lycopersicum)
STRINGXP_009788342.12e-57(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10882485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69600.16e-47zinc finger homeodomain 1
Publications ? help Back to Top
  1. González-Grandío E, et al.
    Abscisic acid signaling is controlled by a BRANCHED1/HD-ZIP I cascade in Arabidopsis axillary buds.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(2): p. E245-E254
    [PMID:28028241]
  2. Li B, et al.
    Network-Guided Discovery of Extensive Epistasis between Transcription Factors Involved in Aliphatic Glucosinolate Biosynthesis.
    Plant Cell, 2018. 30(1): p. 178-195
    [PMID:29317470]