PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678425063
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family GRF
Protein Properties Length: 378aa    MW: 41142.5 Da    PI: 8.3108
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678425063genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC67.61.6e-21158199344
        WRC   3 epgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                epgrC+RtDGKkWRC r+v + +k+CErHlhr+r rsrk+ +
  678425063 158 EPGRCKRTDGKKWRCAREVAPHQKYCERHLHRARPRSRKPPD 199
                9*************************************9865 PP

2QLQ48.72.3e-1797132237
        QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                +FT aQ+ +L++Q+ +yKy+++ +PvPpeLl ++++
  678425063  97 PFTFAQWKELERQAAIYKYMVSCLPVPPELLYPLFR 132
                8******************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-996132IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.3E-1297131IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.62497132IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.294156200IPR014977WRC domain
PfamPF088792.3E-18158197IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MENDGPNATG LCLSEKNKPK SSHLLTRFMI LSEKGDSENC SFLAAEPVRG KGLSDLCHRA  60
GNLTSGGGGG ANTHVNQQLF DDFSYKSPAM AAGIGFPFTF AQWKELERQA AIYKYMVSCL  120
PVPPELLYPL FRNLGSQSVE AGSSSSSSWM RLRSSNLEPG RCKRTDGKKW RCAREVAPHQ  180
KYCERHLHRA RPRSRKPPDD KATQKSDCKK MRTTHKTCCA AASSQDLLTI NDRHPPLLGW  240
HSDSRDAANR AMEPIMAEDH HHLDQGYARL LNQEQPPDIS PFPNLPVGRQ GGKEEEGRKE  300
SGWMRPLPLE LLIGGGPLAE ALQLGPPAGT PPESINAAAT TASSPSGVLQ TTLISHSDGS  360
VCGSPTFCHE AAALLRLT
Cis-element ? help Back to Top
SourceLink
PlantRegMap678425063
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2G9HZL01e-55A0A2G9HZL0_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-30growth-regulating factor 7