PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678423098
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family Dof
Protein Properties Length: 300aa    MW: 33089.4 Da    PI: 8.7215
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678423098genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1177.5e-371775361
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               e+al+cprCds ntkfCyynnyslsqPr+fCk+CrryWtkGGalrnv +Ggg++k+kk+
  678423098 17 EAALRCPRCDSPNTKFCYYNNYSLSQPRHFCKTCRRYWTKGGALRNVLIGGGCQKSKKA 75
               67899***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-231970IPR003851Zinc finger, Dof-type
PfamPF027012.3E-311974IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.8762074IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102258IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSDTKNQRKK AADRPQEAAL RCPRCDSPNT KFCYYNNYSL SQPRHFCKTC RRYWTKGGAL  60
RNVLIGGGCQ KSKKAKGSSK LALDSAADVG GLRLFQVIPP VAMDFQLNVP RLGSPFPGLC  120
YQFPSSNPAI PTNPCFSFDP NPEGPSPSVG LGFSFSSSGF KPLEGTNTAG FQEMGSYSRI  180
FDSESHWKLQ QQRLAMLVSG DYDKEIPSIA IPAIEPATSI QRMQPILFRN LEISNMKQHV  240
TLPTTKDDIT AIPPREWFLE HPYATQQQAP ALATNATNPN ANETTNWSTN EGSFEIISGI
Cis-element ? help Back to Top
SourceLink
PlantRegMap678423098
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022842998.17e-77dof zinc finger protein DOF5.7-like
TrEMBLA0A2G9HTB56e-69A0A2G9HTB5_9LAMI; Uncharacterized protein
STRINGXP_006426240.18e-69(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-36Dof family protein