PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678421780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 395aa    MW: 43730.6 Da    PI: 9.3643
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678421780genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.94.1e-32194247255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  678421780 194 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 247
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15191247IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28192247IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-24194247IPR006447Myb domain, plants
PfamPF002495.6E-7195246IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSIDGVFLEL SSSHIPDLSL QISLPTCGDS SSSKICASKT SLSLHTFDPG TELSLATRQT  60
TEAPKSEKEK NPYQQSFQSH YHGIRPIKGI PVYPSNPQFP FEKDPSMGCL DLLPFSNFAA  120
VVPNRFYHSG SHPYAGCGFD RNPPAVAPYR SRFSVLQPHH YGVGLIPETP PPHHGILRSR  180
FVPKMPPKRS MRAPRMRWTS SLHARFVHAV ELLGGHERAT PKSVLELMDV KDLTLAHVKS  240
HLQMYRTVKT TDKPAASSGQ SEVSVDDDIS SIGVRQFIDP QHEFDLNYTS STPSLWSNSS  300
SSRDGWLRLN DAAESQSVKG ASSFSSASDH QQPMSDSNSR KTIPATIRRN GKASTSHPLP  360
FAPPGHLILP FPHLRRLDLL LHLPLCFCIL RSCNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A5e-17195249357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-17195249357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-17195249357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-17195249357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-17195249458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678421780
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020551952.13e-80transcription repressor KAN1 isoform X2
TrEMBLA0A2G9GLA39e-84A0A2G9GLA3_9LAMI; Uncharacterized protein
STRINGXP_009624603.19e-72(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-54G2-like family protein