PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678420640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 204aa    MW: 23229.6 Da    PI: 8.0497
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678420640genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.9e-32105160156
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                k+r++W++eLH+rF++a++qLGG++ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  678420640 105 KQRRCWSSELHRRFINALQQLGGAHAATPKHIRELMQVDGLTNDEVKSHLQKYRLH 160
                79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.6E-17102163IPR009057Homeodomain-like
PROSITE profilePS5129413.384102162IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-28103163IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-27105160IPR006447Myb domain, plants
PfamPF002491.3E-7107158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MPRKHNNETR PAVRKQLRRC EDDGVCDWDK MKWMSSVQLW NSGNPGTKDQ GKKRLPFSTN  60
ERSEDKAPLL SLAVSETKNE NSSPKSSSGT SPPADSKLNS KTARKQRRCW SSELHRRFIN  120
ALQQLGGAHA ATPKHIRELM QVDGLTNDEV KSHLQKYRLH TRRASALHVN PSFLHCSTPS  180
NHTGEQEEDE EEEDDDDTSE IHNH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520220.16e-39PREDICTED: two-component response regulator-like APRR2
TrEMBLA0A0L9UT126e-39A0A0L9UT12_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T1906e-39A0A0S3T190_PHAAN; Uncharacterized protein
STRINGGLYMA01G21900.13e-36(Glycine max)
STRINGBRADI4G03160.13e-36(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43612443
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-35G2-like family protein