PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678418801
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family ARF
Protein Properties Length: 588aa    MW: 65244.6 Da    PI: 6.3722
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678418801genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3758.7e-24941961100
                EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
         B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                f+kvlt sd++++g +++ +k+a+++     +++++ +++l+  d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + +++el+v+
  678418801  94 FCKVLTASDTSTHGGFSVLRKHANDClppldMSQQTPTQELVSHDLHGIEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--RAETGELRVG 191
                99*********************999****9555556679************************************************..4599****** PP

                EE-SS CS
         B3  96 vfrks 100
                v+r+s
  678418801 192 VRRHS 196
                **985 PP

2Auxin_resp92.66.6e-31220299183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a+ha+ t+++F v+Y+Pr   s+F++ ++k+++a+++++ vGmRfkm fe+eds+err+sGt++gv+d++p + ++SkWr Lk
   678418801 220 ASHAVLTHTIFVVYYKPRI--SQFIIGLNKYLEAMSQNFGVGMRFKMPFEGEDSPERRFSGTIIGVEDVSP-SCEGSKWRTLK 299
                 68999*************8..9*************************************************.9*******996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.7E-4184209IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.98E-4085223IPR015300DNA-binding pseudobarrel domain
CDDcd100175.40E-1992194No hitNo description
PROSITE profilePS5086312.02694196IPR003340B3 DNA binding domain
SMARTSM010192.4E-2294196IPR003340B3 DNA binding domain
PfamPF023629.0E-2294195IPR003340B3 DNA binding domain
PfamPF065079.6E-28220299IPR010525Auxin response factor
PfamPF023097.2E-7456514IPR033389AUX/IAA domain
PROSITE profilePS5174527.857478559IPR000270PB1 domain
SuperFamilySSF542774.32E-13480554No hitNo description
PfamPF023093.9E-6524564IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 588 aa     Download sequence    Send to blast
MASRSALTLQ RHAESEVKDT LYEELWKACA GPLVEVPKVG ERVYYFPQGH IEQAEQDTDE  60
VFAQITLMPE VNQSEPTSPD SHPDEPPRPV VHSFCKVLTA SDTSTHGGFS VLRKHANDCL  120
PPLDMSQQTP TQELVSHDLH GIEWRFKHIF RGQPRRHLLT TGWSTFVTSK RLVAGDSFVF  180
LRAETGELRV GVRRHSRQQS SMPSSVISSQ SMHLGVLATA SHAVLTHTIF VVYYKPRISQ  240
FIIGLNKYLE AMSQNFGVGM RFKMPFEGED SPERRFSGTI IGVEDVSPSC EGSKWRTLKA  300
TSIARPDRVS PWEIEPFVSS VPPSLNLPSA VKPKRLRSHV DVPALVSSLS KKTDVGNASG  360
DMIIEETEGK SASARSSTTN LSRIPGNSPT SCDNASKKSE SAVGCRLFGI DLNMPSVPSC  420
DEMGKSNAPN IDGEASLARM SSSLHWEQQQ PDASKESHEQ KQDQMQEEVL CRSSSFSRSR  480
TKVQMQGVAV GRAVDLPSLK GYEDLIIELE EMFEIKGELR TRNKWEIVYT DDEGDMMLAG  540
DDPWPEFCSM VRRIFICSSQ DVKKMKSRGF PSSSICDKET TAALVSGD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1471731915357Auxin response factor 1
4ldw_A1e-1471731915357Auxin response factor 1
4ldw_B1e-1471731915357Auxin response factor 1
4ldx_A1e-1471731915357Auxin response factor 1
4ldx_B1e-1471731915357Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678418801
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012854189.10.0PREDICTED: auxin response factor 9
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A2G9G9G40.0A0A2G9G9G4_9LAMI; Auxin response factor
STRINGMigut.A00611.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9