PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678416536
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 327aa    MW: 36488.7 Da    PI: 7.6528
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678416536genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP118.14.3e-37109186178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +C v+gC++dls+akey+r+hkvC  hsk+++v+v+gle rfCqqCsrfh+l efD ekrsCrrrL++hn+rrrk+q+
  678416536 109 RCAVDGCDTDLSSAKEYYRKHKVCAEHSKCSTVMVDGLELRFCQQCSRFHSLCEFDREKRSCRRRLHHHNARRRKPQQ 186
                6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.8E-30104171IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.077107184IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-35108189IPR004333Transcription factor, SBP-box
PfamPF031103.1E-29110183IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEWNTGWDLD TVLSFGLGPK QHQQPPHNPK TVPFFAEDEE LLTLTPSTEA PTHNLHFTLF  60
CSQQPQQASP SSSLGLQLGN AGTTTLKPSS PTAASGQTKL SCKNHPPPRC AVDGCDTDLS  120
SAKEYYRKHK VCAEHSKCST VMVDGLELRF CQQCSRFHSL CEFDREKRSC RRRLHHHNAR  180
RRKPQQEIIQ KQHPASPFYR GGDPMGFFLN NDSASHFQQH GAHSSHLMQP DAAGGAAYIN  240
FNQIEAPTEQ GRALSLLSPD QWGIRVREQT VPPPSGYAYG AAAQNETVAY GMGEHGFARE  300
FMLPTQPHAP HRPTPPYELH FYPNGFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-241101831184squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMap678416536
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023770711.12e-45squamosa promoter-binding-like protein 12
RefseqXP_024994203.13e-45squamosa promoter-binding-like protein 12
TrEMBLA0A2J6KYJ74e-44A0A2J6KYJ7_LACSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27360.41e-31squamosa promoter-like 11