PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678416489
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 279aa    MW: 31364.9 Da    PI: 8.2941
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678416489genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.71.9e-3925101278
                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                C v+gC+adls +++yhrrhkvCevhska+ v+++g+eqrfCqqCsrfh+l efD++krsCr+rL++hn+rrrk+++
  678416489  25 CLVDGCDADLSLCRDYHRRHKVCEVHSKAACVTIRGQEQRFCQQCSRFHSLGEFDDGKRSCRKRLDGHNRRRRKPHS 101
                **************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-321786IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.4792299IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3623103IPR004333Transcription factor, SBP-box
PfamPF031103.2E-302598IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MESSSSSGLS KRAKASSKSN QVAHCLVDGC DADLSLCRDY HRRHKVCEVH SKAACVTIRG  60
QEQRFCQQCS RFHSLGEFDD GKRSCRKRLD GHNRRRRKPH SEPLSQNASF LFPNQSAISG  120
ATILSFDGPQ MLPASVVPYS ACPGMVKSET ENELCRLHQH QPIRYIEKPE TFLNFSSHEP  180
HFHDTSITEL RFFSEGLNHR VANSDRALSL LSLAPEATEE LSLNRTVHQE SSHTDARFTP  240
VDQDGRPFTS FSSQYNGLFH SGEGSSSGIS HKKFPFLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-281598184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18198KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678416489
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022881716.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881717.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881718.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881719.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881720.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881721.19e-71squamosa promoter-binding-like protein 16
RefseqXP_022881722.19e-71squamosa promoter-binding-like protein 16
TrEMBLA0A2G9FXF51e-72A0A2G9FXF5_9LAMI; Uncharacterized protein
STRINGVIT_01s0010g03910.t011e-64(Vitis vinifera)
STRINGPGSC0003DMT4000563749e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-44SBP family protein