PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678416134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 582aa    MW: 65390.6 Da    PI: 8.9413
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678416134genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.45.8e-094154521954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   n+yp   ++  LA+++gL+++qV++WF N R +
  678416134 415 FEHflNPYPCDVDKHILARQTGLSKSQVSNWFINARVR 452
                665559******************************88 PP

2BELL101.37.1e-33279347472
       BELL   4 elqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                el++++ kLl++l+eV++rY++y++q++tv+ sFeavag gsa++Y ++A+ka+SrhFr L+d i++qi
  678416134 279 ELERRRKKLLQMLDEVERRYRHYCNQMRTVVMSFEAVAGDGSAAVYSAMASKAMSRHFRRLRDGIMSQI 347
                899*****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.5E-34222345IPR006563POX domain
PfamPF075268.4E-37228343IPR006563POX domain
PROSITE profilePS5007111.872393456IPR001356Homeobox domain
SMARTSM003891.5E-8396460IPR001356Homeobox domain
CDDcd000864.46E-11396457No hitNo description
SuperFamilySSF466895.99E-17397462IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.4E-26399461IPR009057Homeodomain-like
PfamPF059201.5E-16413452IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 582 aa     Download sequence    Send to blast
MRRVASPVLE PGRPGAGPGP PSRHLGEGFT IFCSEKETCA DRTLCKSLHK SPELICAQRT  60
HHLSLPLLHY NLQVKMSKHR TRKMDIEFKR LPAWKRWKTK WMAEQKPGSM TSLAGGFSYS  120
ESCFAGSFES TPVVFNSNAG GMSMEMVGFM SKNLQDYAAP PWSHHQGLDD PSMGCVMFSD  180
GRNGNPNQGL SLSLSSSNPS FRHCDAPSSS GFVALHPPPQ IVPERTTLRD SKYLVPAQDL  240
LNQFCGLRPE NTPKLKPKIQ VPEEDAIKKQ SLYSLDLLEL ERRRKKLLQM LDEVERRYRH  300
YCNQMRTVVM SFEAVAGDGS AAVYSAMASK AMSRHFRRLR DGIMSQIVAT KRAIGEQDVA  360
APGTTKGDTP RLRLVDQTLR QQKALHQTSF MESHPWRPQR GLPERAVTIL RAWLFEHFLN  420
PYPCDVDKHI LARQTGLSKS QVSNWFINAR VRLWKPMVEE IYLEELKESE AMTSNDTTIE  480
DPRDSEYLSS IINTHKKRKG VGAEGGPPPE FLDSLSVDGH TGFRLTLGTG AGDNPSMFFG  540
REETQMGDCQ NYSLLESENQ KPPYRDLMGA QLLHDLAGLK SL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14402460563Homeobox protein Meis2
3k2a_B1e-14402460563Homeobox protein Meis2
4xrm_A9e-15402460563Homeobox protein Meis2
4xrm_B9e-15402460563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073138.11e-139PREDICTED: homeobox protein BEL1 homolog
SwissprotQ388974e-98BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLS8BUT51e-148S8BUT5_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0003s13120.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53001317
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.15e-83TALE family protein