PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678413690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 170aa    MW: 19131.2 Da    PI: 8.417
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678413690genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.82.6e-223684250
               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
        SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50
               Cqv++C+++l++ak yhrrhkvCe+h+ka++vl++g +qrfCqqCsrf 
  678413690 36 CQVDACATNLAHAKPYHRRHKVCEFHAKAAAVLLQGSQQRFCQQCSRFV 84
               ************************************************5 PP

2SBP53.65.8e-171341664577
                TTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP  45 qCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 C rfhelsefD++krsCrrrLa+hnerrrk++
  678413690 134 NCRRFHELSEFDDSKRSCRRRLAGHNERRRKST 166
                7******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-272879IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.93133165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-203585IPR004333Transcription factor, SBP-box
PfamPF031101.9E-173683IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-14134168IPR004333Transcription factor, SBP-box
PfamPF031104.3E-10134164IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.7E-27135152IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGDGEEDEDT SWAASKQIEG GSSSSSSSSS SQRRPCQVDA CATNLAHAKP YHRRHKVCEF  60
HAKAAAVLLQ GSQQRFCQQC SRFVLCSCSQ PNLFAYTTTL YSNEVYLNFD PSIVTPTCTA  120
LRGVVYDKTL PTSNCRRFHE LSEFDDSKRS CRRRLAGHNE RRRKSTYDSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-192683158squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMap678413690
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.22e-25squamosa promoter binding protein-like 4