PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678410706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 272aa    MW: 29431.1 Da    PI: 5.0233
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678410706genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.23.8e-2890142255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 rl WtpeLH++Fv+av+qL G + A+P++i+elm+v+gLt+ehv SHLQkYRl
  678410706  90 SRLIWTPELHTKFVDAVTQL-GVKTAVPRAIVELMDVDGLTREHVSSHLQKYRL 142
                79******************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.1886145IPR017930Myb domain
SuperFamilySSF466897.17E-1986146IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-2987147IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-2290142IPR006447Myb domain, plants
PfamPF002491.2E-694141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MKEEDCNANW FSEWEEELPS PEELVPISQS LITPELASAF DIPGPQETQT PAPPPRVSSA  60
ELDSPEAGVV ADGPSGGSGS DELLRTSKRS RLIWTPELHT KFVDAVTQLG VKTAVPRAIV  120
ELMDVDGLTR EHVSSHLQKY RLYLKRMEEM PNSAGSSPVM AMEPATTDPS FASSPVPPAN  180
SDRFSPSVPV PRPHHTQMRA LPPLPHHFRQ LGSGSPPKGQ LKHPHSQSPA QVPMISPTGT  240
ATLIQQPASN EDLEPKKETK LLNLFPGGGD DS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-1888147463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006339253.17e-66PREDICTED: transcription factor PCL1-like
TrEMBLM1CPV38e-66M1CPV3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000722132e-65(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24322354
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.11e-42G2-like family protein