PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678410252
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 395aa    MW: 44463.1 Da    PI: 5.5492
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678410252genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.54.4e-52281551128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yL++k+ gk++++ ++++e+d+yk+ePw+L   +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v + +++
  678410252  28 LAPGFRFHPTDEELVRYYLRRKACGKPFRF-QAVAEIDVYKSEPWELAdySSLKSRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRAVRH-RNQ 125
                579*************************99.88**************84347777888**************************************.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLvf++grap+g++t+Wvmheyrl
  678410252 126 NIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 155
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.85E-6226178IPR003441NAC domain
PROSITE profilePS5100557.65828178IPR003441NAC domain
PfamPF023655.4E-2830155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGQEAVVVAG VNMRLKPSRL GAPPPTSLAP GFRFHPTDEE LVRYYLRRKA CGKPFRFQAV  60
AEIDVYKSEP WELADYSSLK SRDLEWYFFS PVDRKYGNGS RLNRATGKGY WKATGKDRAV  120
RHRNQNIGMK KTLVFHSGRA PDGKRTNWVM HEYRLCDSEL ERAGVAQDAF VLCRIFQKSG  180
LGPPNGDRYA PFVEEEWDDE ALMVPNGDAE DDMANGDDAL PDAPGVELED QALTMAPPAI  240
PQPLPLMCKR EKSEDCPESS FGQTKRPRQE DPSSGQTNGS EDSTTTCQEH AGRMMTTTNK  300
FSPTLLEFPL LQPVEAKENP PTSHHFTFDS SNLEKSVPPG YLKFISNLEN EILNVSMERE  360
TLKIEVMRAQ AMINVLQSRI DLLVKENDDL RRCGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-532717819168NAC domain-containing protein 19
3swm_B2e-532717819168NAC domain-containing protein 19
3swm_C2e-532717819168NAC domain-containing protein 19
3swm_D2e-532717819168NAC domain-containing protein 19
3swp_A2e-532717819168NAC domain-containing protein 19
3swp_B2e-532717819168NAC domain-containing protein 19
3swp_C2e-532717819168NAC domain-containing protein 19
3swp_D2e-532717819168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101542.10.0PREDICTED: NAC domain-containing protein 78 isoform X2
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-107NAC domain containing protein 50