PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678408525
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 332aa    MW: 36991.1 Da    PI: 6.5045
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678408525genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.14.2e-22135182148
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                +CqvegC+ dl++ak+yhrrh++Ce hsk+p+v++sg+e+rfCqqC +
  678408525 135 CCQVEGCNLDLTSAKDYHRRHRICENHSKSPKVIISGMERRFCQQCNH 182
                6*********************************************74 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.4E-23129182IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.272133210IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-21134182IPR004333Transcription factor, SBP-box
PfamPF031101.8E-18136182IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MEGKPVSNSD LEWEDLVLHG GKPLEPSYFT LSNAFGVNDL RNSSSSSKYP VSATHDSLLE  60
SRDYFKEGSL VPYESTYDNV FSMHRIGGFT EPTIGLKFGR SKEYGDSVFT KSSLPASSFT  120
TKRSRNSYQT LQHPCCQVEG CNLDLTSAKD YHRRHRICEN HSKSPKVIIS GMERRFCQQC  180
NHSMQQHGLF NGLPISQPGA PDEAVRFPGD HFPGSISTLY LDPTRNILQH GLHDPTTNSP  240
MDPHILAAPS LLSWSVNEGE SPTTDGFGQR SYISTVTELN SESYTLPLNA TLPHINRVSL  300
HDPATVVEQS LEYPPLEAPH QPGIYYHGHR NL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A3e-16135181551squamosa promoter-binding protein-like 12
Cis-element ? help Back to Top
SourceLink
PlantRegMap678408525
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093932.13e-38squamosa promoter-binding-like protein 12
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA136441216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-26squamosa promoter binding protein-like 2