PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678407520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 520aa    MW: 58261.4 Da    PI: 7.7761
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678407520genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.8e-103774141954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yps++++  L++++gL+++qV++WF N R +
  678407520 377 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 414
                665559******************************88 PP

2BELL102.23.9e-33237307171
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                er+e q++k kLls+l+eV++rY +y+eq+q +++ F+ v+g g+a+pYt+lA+ka+SrhFrc+kdaia  
  678407520 237 ERTEYQRRKIKLLSMLDEVEERYMRYCEQMQGLVNWFDSVVGRGAAAPYTALAQKAMSRHFRCMKDAIAAE 307
                789*****************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.9E-52168306IPR006563POX domain
PfamPF075261.8E-45174305IPR006563POX domain
PROSITE profilePS5007112.374355418IPR001356Homeobox domain
SMARTSM003893.2E-9358422IPR001356Homeobox domain
CDDcd000862.02E-11358419No hitNo description
SuperFamilySSF466893.12E-17359426IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28361424IPR009057Homeodomain-like
PfamPF059205.3E-18375414IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MKDPGLDLEP QGLGGHPAAY EGMLPEFVWQ KEAGEGPSTA DESQIQQSFR WPQKHHTPVG  60
VNGVPEEHQH QHHHHHPQMK DSSSYLHHLI QNPADPQFQG GHHLIGPSNL AAGPSQFVWA  120
APADEASGLR TGRVLEGQGL SLSLSSTNKL QKMNMEQGDL YFRSQGIIGP SNFLRNSRYL  180
RPAQELLQEF CCVGRGQFKY LKLKTNSDDG NPNAATAAAT SLQTPSSKDR HSLSPSERTE  240
YQRRKIKLLS MLDEVEERYM RYCEQMQGLV NWFDSVVGRG AAAPYTALAQ KAMSRHFRCM  300
KDAIAAELKS ACQLLGEKDV AGSRGLTKGE TPRLKVLEQR YRQQKSLQQM AVLDPESWRP  360
QRGLPERSIN ILRSWLFEHF LHPYPSEADK HLLSRQTGLS KNQVSNWFIN ARVRLWKPMV  420
EEMYQQELQE VHQQGAAAGD AAAARHPSPN INAATTENDL SEEGAASADI SRCFTPERIP  480
DAVPASRNRP AGGVSLTLEL RHSENLPKMR HLSIRDFEAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A2e-16364422563Homeobox protein Meis2
3k2a_B2e-16364422563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009614985.11e-157PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-122BLH4_ARATH; BEL1-like homeodomain protein 4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-122BEL1-like homeodomain 4