PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678407225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 969aa    MW: 107748 Da    PI: 6.7966
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678407225genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.47.7e-42147224178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +CqvegC+adls+ak+yhrrhkvCevhska+++lv +++qrfCqqCsrfh+l+efD++krsCrrrLa+hn+rrrk+++
  678407225 147 ICQVEGCKADLSNAKDYHRRHKVCEVHSKASAALVGNVMQRFCQQCSRFHALEEFDDGKRSCRRRLAGHNKRRRKAHP 224
                5**************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-33143209IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.402145222IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.4E-38147226IPR004333Transcription factor, SBP-box
PfamPF031109.5E-31148221IPR004333Transcription factor, SBP-box
CDDcd002047.92E-5721860No hitNo description
SuperFamilySSF484031.71E-7735860IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.3E-5737863IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MELGGKSHHF YGSVVSEPLN GLGKRSMEWD LNEWRWDGDF LRAAPLNAVP SDCRSRQFFP  60
VCPSLPVKDG FVNFLSPLPH GPAPEAGMDK RDSEKRRRYV EMNEEQNGSL NLNLGGQVCP  120
AIDRDADKWE KSGKKSKLSG VQPSRTICQV EGCKADLSNA KDYHRRHKVC EVHSKASAAL  180
VGNVMQRFCQ QCSRFHALEE FDDGKRSCRR RLAGHNKRRR KAHPENVVGS SAVSDEQGAK  240
YLLTSLLRIL SNTQSSSSGQ TNDQDLLSHL LRNLATVAGA TNPTSPSELL PVSQNSHNAG  300
TVVKDKNPDG RGLTLPSDSL MQKSAPNGFI QVEPACETSP PCSSDASAKV GRIKMSNIDL  360
NSVYDDTEEC SEDFLDNVPR DNPENVSPCL SPWSFKESQR CSPFQNSGNS GSSQSQTPST  420
SSGESRTHTD RIVFKLFNKN PDDLPLDLRK QIFDWLSNSP TDIESYIRPG CIVLTIYACM  480
DKSNWDELHC NLHFNLRKLL NASCDPFWRS EWIYARVQNH ASFAYNGHVV LDKPIPLNAH  540
QSCRISTITP IAVSFSESAH FVIKGYNLTG PSSRLHCALE GRYLLQEKCA DIVGDDYLMS  600
QEEFQCFGFS CNIPDAVGRG FIEVEDYCLN SSFFPFIVAE QDVCAEVRDL ETVIEVTDNA  660
SSDKLEARNQ ALNFVHELGW LLHKSHLVSR LGKLSQDLAL FPFWRYKYLI EFSIDHEWPA  720
VVRKLLDVLL DGTVVAEGNT SVLSALFDVG LLHRAVRKSS VPMVKFLLTY QPTRISIKLE  780
NAHERALTSS FMFKPDASGP GGVTPLHLAA GLDDSDAVID SLTEDPESVG IEAWRNTPDS  840
AGMTPHDYAY LRGHFSYIHL VERKLNKKHG VVALDIPDGT AKQTVEHGGR IAALETEKST  900
RKQLPMMSCK RCRETGAYGS PVAIYRPAML SMLAIAAVCV CAALLFKSSP EVVFSFRPFR  960
WEQLKYGAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-301472211084squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398EKRRRY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00603PBMTransfer from AT2G47070Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678407225
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020547976.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
TrEMBLA0A2G9I0L10.0A0A2G9I0L1_9LAMI; Uncharacterized protein
STRINGPOPTR_0008s09810.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1