PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678405847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 330aa    MW: 37533.5 Da    PI: 7.4779
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678405847genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.83.2e-3079132255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                prlrWtpeLH +Fv a+e+LGG+e+AtPk++l+lm+v gL ++hvkSHLQ+YR+
  678405847  79 PRLRWTPELHLSFVGAIERLGGQERATPKAVLQLMNVRGLRISHVKSHLQMYRS 132
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2875133IPR009057Homeodomain-like
SuperFamilySSF466894.3E-1378133IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-2279134IPR006447Myb domain, plants
PfamPF002497.2E-780131IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDENNKPGEE ETESLRAYSI EEGEEDVSSI DLNEKTRSHA IGGWQTNHGD EKMIEIGSKS  60
REGRDRRSNV RQYIRSQMPR LRWTPELHLS FVGAIERLGG QERATPKAVL QLMNVRGLRI  120
SHVKSHLQMY RSKKLDESGK GRHTQYDFEC LLLTRDDDAV IGQASRFYAI CGHNQFLGSP  180
YMGFGSSSSS SSPLHQLKFE NGGIVFVRNP DSNRYTERPR SFSQNPDARF PFDLKSLSSR  240
HQTQHEPSDF PGSRLVSDTR PNQYPHGRIW PPREVLTCQP LNKEQHNVPS DTVTGDLQLS  300
LSLGPCNHNQ PNDWSKHSNH SDIDTRLSLA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1880134357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678405847
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.12e-59myb-related protein 2
RefseqXP_020546992.12e-59myb-related protein 2
TrEMBLS8BVZ61e-64S8BVZ6_9LAMI; Uncharacterized protein
STRINGMigut.M01030.1.p8e-50(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.17e-34G2-like family protein