PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678405348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 365aa    MW: 40256.9 Da    PI: 8.6839
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678405348genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.96e-4390167178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv+gCe+dls+ak y++rhkvC +hsk+p+v+v+g+eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk+q+
  678405348  90 RCQVQGCEVDLSSAKPYYSRHKVCGFHSKSPEVIVAGIEQRFCQQCSRFHQLSEFDQGKRSCRRRLAGHNERRRKPQP 167
                6**************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.2E-3386152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.11188165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-4089170IPR004333Transcription factor, SBP-box
PfamPF031105.9E-3391164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MFFTRWSSDA PKEEDITMEK GSPSSSSSSS SPSSGAAADS LNGLRFGRKM YFQGMGSGLP  60
PKSSSPLETI SSSPAKRGRT KLLYCNQPPR CQVQGCEVDL SSAKPYYSRH KVCGFHSKSP  120
EVIVAGIEQR FCQQCSRFHQ LSEFDQGKRS CRRRLAGHNE RRRKPQPGSL FSSAFPNLSL  180
LDKHRKTGSF LMNSYTSLPV RDSWVNAATK QVYPDNIWHS SSSQIPLSEY LQVSTSQPLS  240
ISRVSSEECL TAASDSTGAP SLLSYQPWNL RIIPSSSHWF NDNLGPTSTH PESDAPILSQ  300
FSCQPWGFKG IQNSYRVGLT SPELGLGQAS HNVNCDYNEV LPLTQHSEGQ LSEAASSVHH  360
TQWPL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-30911641184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678405348
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020549507.18e-95squamosa promoter-binding-like protein 17 isoform X2
TrEMBLA0A2G9H6R74e-96A0A2G9H6R7_9LAMI; Uncharacterized protein
STRINGXP_010102560.17e-79(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.18e-46squamosa promoter binding protein-like 9