PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678404065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 350aa    MW: 39928.4 Da    PI: 4.9284
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678404065genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.95.4e-55211501129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL++kv + +++l +vik+vd+yk+ePwdL++  ++ aee+ ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s k+
  678404065  21 VPPGFRFHPTDEELVDYYLRRKVGSGSIDL-DVIKDVDLYKIEPWDLQElcRIGAEEQsEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKSIYS-KT 118
                69****************************.9***************954555554445**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                el+g++ktLvfy+grap+g k+dW+mheyrle
  678404065 119 ELIGMRKTLVFYRGRAPNGLKSDWIMHEYRLE 150
                9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.42E-6217170IPR003441NAC domain
PROSITE profilePS5100560.14321170IPR003441NAC domain
PfamPF023651.2E-2822149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MEPADEDKRV LPVNMSGVSK VPPGFRFHPT DEELVDYYLR RKVGSGSIDL DVIKDVDLYK  60
IEPWDLQELC RIGAEEQSEW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKSIYSKTEL  120
IGMRKTLVFY RGRAPNGLKS DWIMHEYRLE SDENAPPQEE GWVVCRVFKK KPVAMQRSGD  180
RYSPLWYDDG AALPEMEALN QKEQQSYPFL YSHTLAYTKK EVSFHHGYFP STLDIHPPTT  240
NFVENPNLDA GCSSFFPMNI SQGSALHQGE EECEGLESLV FSENGEISDN HVTDWRVFDR  300
FVASQLSQEE TFGKNEGFQS GKKRQDTKVG DDGSASILPV NNSTENIEIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-502117115169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076335.11e-123PREDICTED: NAC domain-containing protein 7
SwissprotQ9FWX21e-110NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A068UAL71e-125A0A068UAL7_COFCA; Uncharacterized protein
STRINGGLYMA04G13660.11e-117(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-101NAC 007