PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678403479
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NAC
Protein Properties Length: 396aa    MW: 44283.6 Da    PI: 5.9265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678403479genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.58.9e-52281551128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                l+pGfrFhPtdeelv +yL++k+ +k++++ ++++e+d+yk+ePw+L   +++k+++ ewyfFs+ d+ky +g+r nrat +gyWkatgkd++v + +++
  678403479  28 LAPGFRFHPTDEELVRYYLRRKACAKPFRF-QAVAEIDVYKSEPWELAdySSLKSRDLEWYFFSPVDRKYGNGSRLNRATGKGYWKATGKDRTVRH-RNQ 125
                579*************************99.88**************84347777888**************************************.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLvf++grap+g++t+Wvmheyrl
  678403479 126 NIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 155
                9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6125178IPR003441NAC domain
PROSITE profilePS5100557.33428178IPR003441NAC domain
PfamPF023656.9E-2830155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MGQEAVVVAG ANMRLKSASF GASPPTSLAP GFRFHPTDEE LVRYYLRRKA CAKPFRFQAV  60
AEIDVYKSEP WELADYSSLK SRDLEWYFFS PVDRKYGNGS RLNRATGKGY WKATGKDRTV  120
RHRNQNIGMK KTLVFHSGRA PDGKRTNWVM HEYRLCDSEL ERAGVAQDAF VLCRIFQKSG  180
LGPPNGDRYA PFVEEEWDDD EALMVPNGDV EDEMMANGDD SPALELDDQA LTKAPPATSQ  240
TLPLMCKRER SEDCPESPSV GQTKRSRQEN PSSGQGNGSE DSTTSQQEHP TTMMTTTKLS  300
STLLEFPLLD AKESHPSAHH FTFDSSNLEK SVPPGFLKFI SNLENEILNV SMERETLKIE  360
VMRAQAMINV LQSRIDLLVK DSDALRPGGA SFRQGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-532717816165NO APICAL MERISTEM PROTEIN
1ut4_B2e-532717816165NO APICAL MERISTEM PROTEIN
1ut7_A2e-532717816165NO APICAL MERISTEM PROTEIN
1ut7_B2e-532717816165NO APICAL MERISTEM PROTEIN
3swm_A3e-532717819168NAC domain-containing protein 19
3swm_B3e-532717819168NAC domain-containing protein 19
3swm_C3e-532717819168NAC domain-containing protein 19
3swm_D3e-532717819168NAC domain-containing protein 19
3swp_A3e-532717819168NAC domain-containing protein 19
3swp_B3e-532717819168NAC domain-containing protein 19
3swp_C3e-532717819168NAC domain-containing protein 19
3swp_D3e-532717819168NAC domain-containing protein 19
4dul_A2e-532717816165NAC domain-containing protein 19
4dul_B2e-532717816165NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619467.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016432498.10.0PREDICTED: NAC domain-containing protein 78-like
TrEMBLA0A068TWS90.0A0A068TWS9_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000797910.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.11e-100NAC domain containing protein 52