PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678402926
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 481aa    MW: 52755.5 Da    PI: 7.9402
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678402926genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32327380255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  678402926 327 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 380
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-15324380IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28325380IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23327380IPR006447Myb domain, plants
PfamPF002497.4E-7328379IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MYTEPVFLRP SIYLLIVGRV IHTVAAALSA VKRGSLEIFA FQTFLRGGKI FAKTEAFSIR  60
VVVVVRLVLG IGILICIEDK EEEEEEEEEE GEKMSTEGVF LELSSSQMPD LSLQISPPNF  120
VSSPKNRHQQ QQVHNFDLSV TGTSTDAAAA APATELSLRT NFEVPKSFSG GNQQDPQNPF  180
QNYAVQSSSS QPIKGIPVYP PTNRPFPFLP LEQKDPKTRF YQMPSWTSPP ISHPYFTGAA  240
PMDHHHHHLP MMNLTANGAP AAGGAGLYRG PVAAASRIVG AGGFHQMHPQ SYPHQFGIEG  300
GGGAPHPGVM RSRFLPKMQS KRSMRAPRMR WTSSLHARFV HAVELLGGHE RATPKSVLEL  360
MDVKDLTLAH VKSHLQMYRT VKTTDKPAPS SGHSEGSGGE DDISTIGSDR PTGIRQIIDQ  420
RDPLVDSDTN YTSSNPRLWS NSSSNRDGWL RMNAGESQSL VGSSSHLVRN TSSKELCNVQ  480
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16328382357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16328382357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16328382357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16328382357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16328382458Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMap678402926
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020551952.11e-101transcription repressor KAN1 isoform X2
TrEMBLA0A2G9GLA31e-112A0A2G9GLA3_9LAMI; Uncharacterized protein
STRINGcassava4.1_008805m2e-80(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.16e-45G2-like family protein