PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678400268
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 313aa    MW: 35405.6 Da    PI: 8.7024
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678400268genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP72.29.2e-232573250
               -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
        SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50
               C v+gCeadls +++yhrrhkvCe+hsk+++v+++g++qrfCqqCsr+ 
  678400268 25 CLVDGCEADLSLCRDYHRRHKVCEIHSKTAKVTIRGQHQRFCQQCSRYI 73
               ***********************************************95 PP

2SBP44.63.7e-14981284878
                SEEETTT--SS--S-STTTT-------S--- CS
        SBP  48 rfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                 fh+l efD++krsCr+rL++hn+rrrk+q+
  678400268  98 MFHSLGEFDDGKRSCRKRLDGHNRRRRKPQP 128
                6***************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-2518113IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.89722126IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-212374IPR004333Transcription factor, SBP-box
PfamPF031103.3E-162572IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-1198131IPR004333Transcription factor, SBP-box
PfamPF031101.4E-798125IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDSSSSSGSS KRAKASSKCS QVAHCLVDGC EADLSLCRDY HRRHKVCEIH SKTAKVTIRG  60
QHQRFCQQCS RYITTKFVDP PPLDMQCFLV IRQFHDAMFH SLGEFDDGKR SCRKRLDGHN  120
RRRRKPQPET LSQNSSFLFP SQSSLSGTTI ISFGSPPVLP ASVVPSLWPG IVKSENDMEL  180
YRYNQHHQVC YNEKPELFLN FSSHSFKEVY HQPHFNGTSV TDPKVFSEGL NHRVVSSDRA  240
LSLLSLAPEA TEEFSLNHSA RHESSSLTDP RFSTVDQDSK PLASSSQYNN DLFHHGEGSS  300
SGRSHKKMPF LWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-21251251184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108125KRSCRKRLDGHNRRRRKP
Cis-element ? help Back to Top
SourceLink
PlantRegMap678400268
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022891276.11e-77squamosa promoter-binding-like protein 16
RefseqXP_022891277.11e-77squamosa promoter-binding-like protein 16
RefseqXP_022891278.11e-77squamosa promoter-binding-like protein 16
TrEMBLA0A2Z7ARB52e-81A0A2Z7ARB5_9LAMI; Squamosa promoter-binding-like protein 16-like
STRINGPGSC0003DMT4000563743e-72(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49202037
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.14e-36SBP family protein