PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678397124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 223aa    MW: 24804.1 Da    PI: 5.5097
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678397124genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.2e-26959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+i+n+  rqvtfskRr g++KKAeEL vLCd ev +i+fs +gklyey+s
  678397124  9 KKIDNTAARQVTFSKRRRGLFKKAEELAVLCDSEVGLIVFSASGKLYEYAS 59
               68***********************************************86 PP

2K-box50.11.2e-17921711998
      K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                 ++++L ke+    r +R + Ge+L+ Ls++eLqqLe+ +e++l+++ +kK e ++++i +lq+k k+l +en++L++ +
  678397124  92 SNYSRLSKEVADRTRHLRLMRGEELQGLSIEELQQLETSIESGLNRVMEKKGEKIMSEIGRLQEKGKQLMDENEKLNQLV 171
                67899999999999**************************************************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.1E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.927161IPR002100Transcription factor, MADS-box
CDDcd002659.42E-39268No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-26323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.23E-28369IPR002100Transcription factor, MADS-box
PfamPF003191.1E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129711.93387180IPR002487Transcription factor, K-box
PfamPF014861.3E-1592169IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MAREKIEIKK IDNTAARQVT FSKRRRGLFK KAEELAVLCD SEVGLIVFSA SGKLYEYASS  60
SMKEILERRD LNSKNLTANG RPPVGMQLAE DSNYSRLSKE VADRTRHLRL MRGEELQGLS  120
IEELQQLETS IESGLNRVME KKGEKIMSEI GRLQEKGKQL MDENEKLNQL VADIAYYGND  180
MVAAESMNMG SDEGPWSESL SSSSNGPPQG CHSSDASLKL GLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-19166166MEF2 CHIMERA
6byy_B4e-19166166MEF2 CHIMERA
6byy_C4e-19166166MEF2 CHIMERA
6byy_D4e-19166166MEF2 CHIMERA
6bz1_A5e-19166166MEF2 CHIMERA
6bz1_B5e-19166166MEF2 CHIMERA
6bz1_C5e-19166166MEF2 CHIMERA
6bz1_D5e-19166166MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678397124
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554864.11e-97MADS-box protein SVP
SwissprotQ9FUY69e-89JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLS8D1G31e-102S8D1G3_9LAMI; Uncharacterized protein
STRINGXP_009783886.13e-95(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-83MIKC_MADS family protein
Publications ? help Back to Top
  1. Nakano T,Kato H,Shima Y,Ito Y
    Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities.
    Plant Cell Physiol., 2015. 56(6): p. 1097-106
    [PMID:25746985]