PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678395993
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 954aa    MW: 106014 Da    PI: 6.4575
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678395993genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.4e-41144221178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqve+C+adls+ak+yhrrhkvCevhska+ +lv +++qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+++
  678395993 144 VCQVEDCKADLSSAKDYHRRHKVCEVHSKASRALVGNVMQRFCQQCSRFHALEEFDEGKRSCRRRLAGHNKRRRKAHP 221
                6**************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.9E-33138206IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.342142219IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.42E-38143223IPR004333Transcription factor, SBP-box
PfamPF031101.1E-29145218IPR004333Transcription factor, SBP-box
SuperFamilySSF484034.97E-8724847IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.4E-8737852IPR020683Ankyrin repeat-containing domain
CDDcd002044.71E-6738846No hitNo description
PROSITE profilePS500888.603787820IPR002110Ankyrin repeat
PROSITE profilePS502978.773787847IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 954 aa     Download sequence    Send to blast
MELGGSLRRV YGSVVSEPLS GLGKSTEWDL NDWTWDGDFL RAAPLTAVPS DCRSRKFFPI  60
GFDPPVKDGC LNFLSHEHVL EDGMEKRDTE KRRRHIEINE EEDNGSLSLK LGGHVPPVVD  120
GDSGKWEKGR KKSKLSDSQS SRAVCQVEDC KADLSSAKDY HRRHKVCEVH SKASRALVGN  180
VMQRFCQQCS RFHALEEFDE GKRSCRRRLA GHNKRRRKAH PENVVATSAL TDEQGAKYLL  240
TSLLRILSNT QSNSSEQTND QELLSHLLRN LATVAGSAGT TSPSRLLPSS QNSHNMGTVH  300
KETSPDGRGF TLPFDSPHKS TLTDIVQVET ACETSPPCSS NGSAKVGRIK MSGIDLNSPY  360
DDTEDHMEDF VDNAPHDNPE NVSPCLVPWS FKEPQRSSPL QNSGNSVSLW SQSPSTSSGE  420
SRTHTDRIVF KLFGKNPSDL PLDLRKQILD WLSTSPTDIE SYIRPGCVIL TIYACMDKSN  480
WDELYYNLHS SLRKLLDESC DPFWRTEWIY TRVQHHASFA YNGMLISISG NWLDIHSFFQ  540
KTTGDYLIVA PSCNCTRLHC ALEGKYLLQE SCADTVKDDF LTNQEEQVQC ISFSCTIPNA  600
VGRGFIEVED CCLSSSFFPF IVAEKDVCTE IRGLENIIDA TNDATPDTSK CEARSQALNF  660
VHEIGWLLHK THLVFRSGKL SEDLDPFPFW RYKFLIEFAI DHEWPAVARK LLDVLMDGTV  720
VADGSMSVFA ALSDVGLLHR AVRKTSLPMV KFLLTYQPSG ISVQTGDAHE QVAGNRFLFK  780
PDAAGPGGLT PLHVAAGLDD SEAVIDSLTE NPASVGIEAW KSARDSAGLT PHDYARLRGH  840
HSYIHLVQSK LNKKHDQVVV DIPDGAAKQS TEDVSRVGAA ALATEKSTRK QLNCKRCRDT  900
MAYGSPVALY RPAMLSMLAI AAVCVCAALL FKSSPEVIFS FRPFRWEQLE YGAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-301442181084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap678395993
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020547976.10.0LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 1
TrEMBLA0A2G9I0L10.0A0A2G9I0L1_9LAMI; Uncharacterized protein
STRINGXP_004297083.10.0(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1