PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678393364
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 509aa    MW: 57415.4 Da    PI: 7.1282
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678393364genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.81e-093684051954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yps++++  L++++gL+++qV++WF N R +
  678393364 368 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 405
                664459******************************88 PP

2BELL101.94.8e-33228298171
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                er++ q++k kLls+l+eV++rY +y+eq+q++++ F+ ++g g+a+pYt+lA+ka+SrhFrc+kdaia+ 
  678393364 228 ERADYQRRKMKLLSMLDEVEERYMRYCEQMQALVNWFDSMVGRGAAAPYTALAQKAMSRHFRCMKDAIAGE 298
                68999***************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.6E-51165297IPR006563POX domain
PfamPF075262.2E-45171296IPR006563POX domain
PROSITE profilePS5007112.228346409IPR001356Homeobox domain
CDDcd000861.92E-10349410No hitNo description
SMARTSM003897.2E-9349413IPR001356Homeobox domain
SuperFamilySSF466893.25E-17351417IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28353415IPR009057Homeodomain-like
PfamPF059205.2E-18366405IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MHRQGEWIMK GQELDMQAAG EFTRNPDYVT GEMLAEFVTA GEGPSMVEEN QIQPTFWWPE  60
KQHLSVGVVN GAAAEELHFM NNQIKDSSSS SSSTSPYLHQ LVQAGTHPQN LFNWADPGGD  120
GSLRTGNFLS LSPSLRNAEA NKLHKMNVEQ TELLFRSQGI GLSNYSLANF LRNSRYLRPS  180
QELLQEFCCV GRGQFKNLKL RSHERNPNSG GSSKASQSKD RNSLSPSERA DYQRRKMKLL  240
SMLDEVEERY MRYCEQMQAL VNWFDSMVGR GAAAPYTALA QKAMSRHFRC MKDAIAGELK  300
SACQLLGDKD VAGSRGLTKG ETPRLKMLDQ RYRQQKSLQQ MAVIDPESWR PERGLPERSV  360
NILRSWLFEH FLHPYPSEAD KHLLSRQTGL SKNQVSNWFI NARVRLWKPM VEEMYQQELH  420
EAQQQEAANP AAPQPNINNA AENDLSESGA ISSSSAEAIA EISRCYGTKK TDGCDGNPVA  480
GDVSLTLELR RSENLPNMRQ LSIRDFEAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16355413563Homeobox protein Meis2
3k2a_B1e-16355413563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074481.11e-162PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-121BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4BV621e-133K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.11e-132(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-117BEL1-like homeodomain 4