PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678392421
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family SBP
Protein Properties Length: 274aa    MW: 30514.4 Da    PI: 9.0128
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678392421genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP126.31.3e-3991167177
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                +CqvegC++dl+eak yhrrh++Ce hsk+p v+v+g+e rfCqqCsrfh+lsefD++krsCrrrL++hn+rrr+ +
  678392421  91 CCQVEGCSVDLKEAKGYHRRHRICENHSKSPRVIVQGMESRFCQQCSRFHALSEFDDKKRSCRRRLSDHNARRRRLH 167
                6*************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.3E-3485153IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.04389166IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-3790171IPR004333Transcription factor, SBP-box
PfamPF031102.5E-3292165IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MEDKGICMGS SQLEWNDVVV HDGNQKQICF SVSRSNDHGA ACCSSSSSNY LMATHQMGCL  60
PPYKKPKSSP LAVSPKKPKI SSSAHHAGNP CCQVEGCSVD LKEAKGYHRR HRICENHSKS  120
PRVIVQGMES RFCQQCSRFH ALSEFDDKKR SCRRRLSDHN ARRRRLHVET IRLRPPHASS  180
SFYDLMKMEQ NGLLNRLPFS PPEPLDRRTI CFSSNEMESP VSDHMIFLNA SSLLSTNSGS  240
TTYNPATARE SFCHGNTVFA TGSTGFPAMS GTSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2887165684squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1147164KKRSCRRRLSDHNARRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMap678392421
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022888133.17e-48squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_022888134.17e-48squamosa promoter-binding-like protein 12 isoform X2
RefseqXP_023874058.17e-47LOW QUALITY PROTEIN: squamosa promoter-binding-like protein 3
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-38squamosa promoter binding protein-like 2