PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678391280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 367aa    MW: 40709.6 Da    PI: 7.035
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678391280genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.47.5e-343892155
    G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
               kprl+Wtp+LH+rFveav++LGG+ekAtPk++++lm+++gLtl+h+kSHLQkYRl
  678391280 38 KPRLKWTPDLHQRFVEAVNHLGGAEKATPKSVMKLMGIQGLTLYHLKSHLQKYRL 92
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.0973595IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-313693IPR009057Homeodomain-like
SuperFamilySSF466891.79E-163793IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-243893IPR006447Myb domain, plants
PfamPF002498.8E-104091IPR001005SANT/Myb domain
PfamPF143791.4E-24132179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MYHQHHPGQS LTPERHLFVQ GMKNGSGDLG LVLSTDAKPR LKWTPDLHQR FVEAVNHLGG  60
AEKATPKSVM KLMGIQGLTL YHLKSHLQKY RLSKSLCGQA NNSSNKAATG DRTTSTTPPS  120
NQNTPTHTNK NIHIGEAIQM QIEVQRRLHE QLEVQRHLQL RIEAQGKYLQ SVLEKAQETI  180
GTQNLGTLNL EEAKVHLSDL VSEVSTQYLT SAFPGMKELE DICLQKNTLS RPVAQSMDSC  240
TTSFECSIRD RESYNGLMGF RPVSFRSPMD SQHEKKIENT DLGATEYLKE SRNIFSTERN  300
NAEKGSAAET DSSNLTMSIG VPESNGSIAS GLKLQSLSSS PLDLNTYEEN TAPSLSNQLD  360
LNGFCWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-223794158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap678391280
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094327.21e-146myb-related protein 2 isoform X1
SwissprotQ9SQQ91e-106PHL9_ARATH; Myb-related protein 2
TrEMBLA0A2Z7B2B11e-135A0A2Z7B2B1_9LAMI; Transcription factor
STRINGXP_002525443.11e-129(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-105myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]