PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678389446
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 24898.5 Da    PI: 8.5912
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678389446genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF98.92e-3169119151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                krienk++rqvtf+kRrngilKKA+ELSvLCdaeva+iifs++gklye+ss
  678389446  69 KRIENKIKRQVTFAKRRNGILKKAYELSVLCDAEVALIIFSNRGKLYEFSS 119
                79***********************************************96 PP

2K-box51.73.7e-18141202768
      K-box   7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRsk 68 
                ++++ +k+++++ e+ +Lk+++++Lq+ qR+llGedL+sL+l++L+ +e+qL++slk i sk
  678389446 141 TATDREKEQTSYMEYLQLKSRYQELQQLQRQLLGEDLKSLNLRDLEAIEKQLQSSLKAIGSK 202
                446778899************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.68361121IPR002100Transcription factor, MADS-box
SMARTSM004322.5E-4161120IPR002100Transcription factor, MADS-box
CDDcd002651.84E-4162133No hitNo description
SuperFamilySSF554555.89E-3462148IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-326383IPR002100Transcription factor, MADS-box
PROSITE patternPS00350063117IPR002100Transcription factor, MADS-box
PfamPF003199.3E-2670117IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-328398IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-3298119IPR002100Transcription factor, MADS-box
PfamPF014866.6E-13144201IPR002487Transcription factor, K-box
PROSITE profilePS512978.688148219IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MRWDEGVPQL EPIEFISYEV VALSCHSHRL GDGHLSWFSG GVAVLAKEEA KSVHDSKSSN  60
MGRGKIELKR IENKIKRQVT FAKRRNGILK KAYELSVLCD AEVALIIFSN RGKLYEFSSS  120
SNMMETIEKY QKCCFGSMEA TATDREKEQT SYMEYLQLKS RYQELQQLQR QLLGEDLKSL  180
NLRDLEAIEK QLQSSLKAIG SKGVGSSFPL FSSAFFTFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A2e-1861130169MEF2 CHIMERA
6byy_B2e-1861130169MEF2 CHIMERA
6byy_C2e-1861130169MEF2 CHIMERA
6byy_D2e-1861130169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap678389446
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099041.11e-66developmental protein SEPALLATA 1 isoform X2
SwissprotQ8LLR22e-64MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBLS8EDZ42e-67S8EDZ4_9LAMI; Uncharacterized protein
STRINGGLYMA18G50900.15e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15800.13e-55MIKC_MADS family protein
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]