PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678389235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TCP
Protein Properties Length: 339aa    MW: 37933.1 Da    PI: 10.5591
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678389235genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP96.16.8e-30142213273
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                 g+kdrhsk++T +g+RdRRvRls+++a +++dLq +LG+ ++sk ++WL+++ak+ i+el+ ++ ++ s++
  678389235 142 FGRKDRHSKVCTVKGLRDRRVRLSIPTAMQLYDLQHRLGLSQPSKVVDWLMNAAKKDIDELPPLQIPPGSFV 213
                689*************************************************************88887666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.0E-26143205IPR005333Transcription factor, TCP
PROSITE profilePS5136929.34144202IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MISSSKHDWH LPTHLPNLGR KSCSTPRAME PASGNRLGNQ IKTAGEARRS SQKSREVNGR  60
RGWSSLAEQG EVVHVSVILF DSWHVYSWFR LKIRHLRRGE GMKTLESSKK GSKPYSGASA  120
PITSWSCSRI RDPRIVGVSR AFGRKDRHSK VCTVKGLRDR RVRLSIPTAM QLYDLQHRLG  180
LSQPSKVVDW LMNAAKKDID ELPPLQIPPG SFVSPSFQTL IAPISDKPGG GFKVSGSSWP  240
PYAANKSVYG GCLNPSTSSC LRWGSPSLSL SHPPSSKEED WQILHWQQSL IYHQGITPPT  300
SLRFGQETES ERAAMEFNIT ENFLPEENLQ SKDHPFLTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A3e-16149203155Putative transcription factor PCF6
5zkt_B3e-16149203155Putative transcription factor PCF6
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14753RRSSQKS
Cis-element ? help Back to Top
SourceLink
PlantRegMap678389235
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPGSC0003DMT4000034534e-45(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02150.12e-41plastid transcription factor 1