PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678387022
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family G2-like
Protein Properties Length: 362aa    MW: 39656.5 Da    PI: 8.2652
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678387022genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.6e-32199252255
    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  678387022 199 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 252
                9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15196252IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28197252IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-24199252IPR006447Myb domain, plants
PfamPF002494.9E-7200251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSVEGVFLEL SSSKIPDLSL QISLPNCESS SSKICASKAC VSLHTFDLDT DLSLATTQTT  60
DAPGSEKEQN PYHQCSPSHH GGIRPIKGIP VYPTNPQFPL EKDPNMGCGD LLSFSKFTGV  120
FPNRFYQMPS SSPPTSISHP YFAGGLDHNP SASAAYRSRF PVLQPQHYGV GLLPEPPHHG  180
IMRSRFVPKM PPKRSMRAPR MRWTSSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL  240
AHVKSHLQMY RTVKTTDKPA ASSGQSEVSG EDDLSPRRAR SIGIRPFADP QHESDPNYTP  300
SIWRHPSHSG GDGWLRLNAA AESQSVQGPS SLSSTSDHKD VIWKSSLSEE RATFSSDHSK  360
SA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085885.15e-85PREDICTED: transcription repressor KAN1
TrEMBLF6HI082e-69F6HI08_VITVI; Putative uncharacterized protein
STRINGVIT_04s0043g00340.t017e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-55G2-like family protein